seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.zakat.org/en
Your general SEO Checkup Score
Archived
86/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 86 out of 100, which is higher than the average score of 75. Our analysis has identified 16 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
16 Failed
3 Warnings
32 Passed
Common SEO issues
Score: 86
Failed: 1
Warnings: 1
Passed: 15
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Zakat Foundation of America - Zakat Foundation of America
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Home - Zakat Foundation of America - The Leader in empowering lives around the globe.
Google Search Results Preview Test
Desktop version
https://www.zakat.org/enZakat Foundation of America - Zakat Foundation of AmericaHome - Zakat Foundation of America - The Leader in empowering lives around the globe.
Mobile version
https://www.zakat.org/enZakat Foundation of America - Zakat Foundation of AmericaHome - Zakat Foundation of America - The Leader in empowering lives around the globe.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
13zakat7read6programs5orphan5foundation
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
adaqafricaamericaamericasaqeeqaharabicarchiveasiablessedblogcalculatorcareercenterchildrencompletecontactdecemberdevelopmentdisastersdonatedonationdonoreastemergencyempowerempoweringempowermenteuropefamilyfaqsfeedfieldfinancialfoundationfundedfuturegalleriesgeneralgivingglossaryhistoryhopeinformationinvolvedjanuaryjariyahlatestleadershiplegallightsliveslovemiddlemissionnaturalnewsnewsletternewsroomopportunitiesorphanorphanedpartnersphotophotospolicypoundspressprivacyprogramprogramsprojectsprovidepublicationsquicklyreadreleasesreliefresourcerespondrightssadaqaschoolsseasonalsponsorsponsorshipsunnahteamtimestraditionupdatesupholdvideovideosvisionwaysworkyearyearszakatالعربية
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Latest Updates from the Field
Latest Photos & Videos
Turning On the Lights, Again.
Syrian Refugee Crisis: YOU are all it takes
Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 6
Failed: 9
Warnings: 2
Passed: 0
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 80% - from 92.13 Kb to 18.47 Kb .
Site Loading Speed Test
  • Your website loading time is around 6.58 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 140
  • 3 HTML Pages
  • 30 CSS Files
  • 61 JS Files
  • 46 Images
  • 0 Flash Files
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
URL Redirects Test
  • Your URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 27
Failed: 2
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 2
Warnings: 0
Passed: 4
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.zakat.org/en is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.zakat.org/en/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved