seo site checkup logo
PricingFree ToolsArticles
Report generated 10 months ago
https://www.xiaomistore.pk
Your general SEO Checkup Score
Archived
71/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 71 out of 100, which is below the average score of 75. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
4 Warnings
53 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
To implement responsive design functionalities, it is recommended to use CSS media queries.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 68
Failed: 5
Warnings: 2
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 62 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Mi Pakistan - Xiaomi Online Store in Pakistan – XiaomiStore.pk
Length: 62 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Shop online at Xiaomi Store for Mi Products Mi Smart Devices, Mi Power Banks, Mi Headphones, Mi Earphones, Mi TV and more from Xiaomi Store in Pakistan, Cash on delivery supported.
Length: 180 characters
Google Search Results Preview Test
Desktop version
https://www.xiaomistore.pk/Mi Pakistan - Xiaomi Online Store in Pakistan – XiaomiStore.pkShop online at Xiaomi Store for Mi Products Mi Smart Devices, Mi Power Banks, Mi Headphones, Mi Earphones, Mi TV and more from Xiaomi Store in Pakistan, Cash on delivery supported.
Mobile version
https://www.xiaomistore.pk/Mi Pakistan - Xiaomi Online Store in Pakistan – XiaomiStore.pkShop online at Xiaomi Store for Mi Products Mi Smart Devices, Mi Power Banks, Mi Headphones, Mi Earphones, Mi TV and more from Xiaomi Store in Pakistan, Cash on delivery supported.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Xiaomi Store Pakistan
og:locale
en-IN
og:region
IN
og:country-name
Pakistan
og:type
website
og:title
Xiaomi Store Pakistan
og:description
Shop online at Xiaomi Store for Mi Products Mi Smart Devices, Mi Power Banks, Mi Headphones, Mi Earphones, Mi TV and more from Xiaomi Store in Pakistan, Cash on delivery supported.
og:image
https://www.xiaomistore.pk/xiaomi_images/website/624fd342a6756_1649398594.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
55xiaomi38smart24redmi24camera18power
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
xiaomi
smart
redmi
camera
power
Keywords Cloud Test
accessoriesandonandroidappliancesaudiobandbandsbankbanksbestbloodbluetoothbrowsebudscablescameracamerascarecartchargechargerchargersclaimcomputerconfidencecustomerdashdestinationdevicesdronesdualearbudsearphoneselectricelectronicextenderfastfitnessgifthavehaylouheadphoneshealthhelphomehumidifierkettlekeyboardkitchenlifestylemachinemiiiwminimobilesmodemonitornoteonlineorderoutdoorpakistanpersonalpopularportablepowerpressureproductproductspurifierpurifiersrangeredmiroutersecurityserviceshippingshopshoppingsignsmartspeakersstationarystorestripsupportthermometertoolstracktruetypeversionvisualwarrantywatchwatcheswifiwiredwirelessxiaomixiaomistore
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Smart Devices
Mi Audio
Mi Power Devices
Mi Camera & Visual
Mi Lifestyle
Our YouTube Partner
Here's What People Are Buying
Latest From Blogs
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 63
Failed: 8
Warnings: 1
Passed: 16
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 18.9 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,594 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 120.57 Kb to 18.9 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 6.37 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
65.0 %
593.50 Kb
javascript
26.1 %
238.36 Kb
other
3.3 %
30.26 Kb
css
2.1 %
19.36 Kb
html
2.0 %
18.68 Kb
font
1.4 %
13.21 Kb
TOTAL
100%
913.37 Kb
Requests by content type
Content type
Percent
Requests
image
58.7 %
27
javascript
23.9 %
11
css
6.5 %
3
other
6.5 %
3
html
2.2 %
1
font
2.2 %
1
TOTAL
100%
46
Content size by domain
Domain
Percent
Size
xiaomistore.pk
83.2 %
759.69 Kb
analytics.tiktok.com
15.1 %
137.88 Kb
at.alicdn.com
1.6 %
15.00 Kb
analytics.pangle-ads.com
0.1 %
824 B
TOTAL
100%
913.37 Kb
Requests by domain
Domain
Percent
Requests
xiaomistore.pk
84.8 %
39
analytics.tiktok.com
8.7 %
4
at.alicdn.com
4.3 %
2
analytics.pangle-ads.com
2.2 %
1
TOTAL
100%
46
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 1.132 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.132 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.104 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.104 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 5.5 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.5 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img class="swiper-lazy swiper-lazy-loaded" src="https://www.xiaomistore.pk/xiaomi_images/website/6..." alt="https://www.xiaomistore.pk/deals">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0005. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0005

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Most Popular Computer Accessories Android TV Box Fitness Bands Mi Camera Drones
Html: <div class="more">
Score: 0.0004
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.xiaomistore.pk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
xiaomistore.pk
Subject Alternative Names (SANs)
xiaomistore.pk, *.xiaomistore.pk
Not valid before
Mon, April 29o 2024, 7:56:47 pm (z)
Not valid after
Sun, July 28o 2024, 7:56:46 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1,maximum-scale=1,minimum-scale=1,user-scalable=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.xiaomistore.pk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.xiaomistore.pk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.elasticemail.com include:mxlogin.com include:amazonses.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved