seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
http://www.washing-machine-customer-care.in
Your general SEO Checkup Score
Archived
56/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 56 out of 100, which is below the average score of 75. However, there are 26 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
26 Failed
2 Warnings
39 Passed
Common SEO issues
Score: 71
Failed: 7
Warnings: 1
Passed: 17
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Washing Machine Service Centre 9818206309 | Washer Repair Near Me
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Find ✓Samsung Washing Machine Service Center, ✓Washing Machine Repair, ✓LG Washing Machine Repair Services in Gurgaon. Get Phone Numbers of VideoCon, IFB Washing Machine Repair near me in Delhi.
Google Search Results Preview Test
Desktop version
http://www.washing-machine-customer-care.inWashing Machine Service Centre 9818206309 | Washer Repair Near MeFind ✓Samsung Washing Machine Service Center, ✓Washing Machine Repair, ✓LG Washing Machine Repair Services in Gurgaon. Get Phone Numbers of VideoCon, IFB Washing Machine Repair near me in Delhi.
Mobile version
http://www.washing-machine-customer-care.inWashing Machine Service Centre 9818206309 | Washer Repair Near MeFind ✓Samsung Washing Machine Service Center, ✓Washing Machine Repair, ✓LG Washing Machine Repair Services in Gurgaon. Get Phone Numbers of VideoCon, IFB Washing Machine Repair near me in Delhi.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
343washing320machine284service109delhi98gurgaon
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
affordableapplianceappliancesautomaticavailablebestboundariesbrandbrandscarecentercenterscentrechargeschoosecityclassclothescontactcostcustomercustomersdaysdelhidetailsdevicedwarkaelectronicengineerengineersexpertexpertsfixedfreefriendlygurgaongurugramhasslehavehavinghelphomeindiainspectioninstallationissuesjustknownlifelikeloadinglookingmachinemachinesmaintenancemakemakesmanufacturerminimumnearneedneedsnumberpeopleproblemproductprofessionalproperprovideproviderprovidingqualityrepairrepairingsamsungscheduleselectsemiserviceservicesskilledsolvestandardssuperiorsupportteamtechnicianstimetrainedtypesusagevideoconvisitwasherwashingwhirlpoolworkworkingworldworry
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Welcome to Our Washing Machine Service Center For Repair Service And AMC For Samsung, LG, Videocon & IFB Brands in Delhi and Gurgaon
H2 tags
Contact Washing Machine Repair Service Center in Gurgaon, Delhi NCR
Contact Details of Washing Machine Service Centers in Gurgaon?
Contact Details of Washing Machine Service Centers in Delhi and New Delhi?
Get Your Washing Machine repaired At the Best Repair Center in Gurgaon
How to approaches our Washing Machine Service Center:
Why LG Washing Machine Service Center?
LG Washing Machine Service Centre
Easiest Way To Find A LG Washing Machine Service Center In Gurgaon & Delhi NCR
Samsung Washing Machine Repair Service Center Number for Delhi-NCR and Gurgaon
Samsung Washing Machine Service Centre
Get the nearest Samsung service center in Gurgaon & Delhi NCR
Samsung Washing Machine Customer Care Delhi and Gurgaon & Helpline Number
VideoCon Washing Machine Service Center & Whirlpool Washing Machine Customer Care
Robots.txt Test94% of top 100 sites passed
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
11center
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta http-equiv="Content-Type" content="text/php; charset=utf-8"
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 37
Failed: 11
Warnings: 1
Passed: 8
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,430 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 77% - from 77.78 Kb to 18.07 Kb .
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 2.47 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
31.5 %
351.81 Kb
javascript
24.0 %
267.73 Kb
css
22.2 %
248.14 Kb
other
11.3 %
126.56 Kb
html
7.3 %
81.59 Kb
font
3.7 %
41.53 Kb
TOTAL
100%
1.09 Mb
Requests by content type
Content type
Percent
Requests
image
54.5 %
18
javascript
27.3 %
9
css
6.1 %
2
font
6.1 %
2
html
3.0 %
1
other
3.0 %
1
TOTAL
100%
33
Content size by domain
Domain
Percent
Size
washing-machine-customer-care.in
94.8 %
1.03 Mb
googletagmanager.com
3.4 %
37.64 Kb
google-analytics.com
1.8 %
19.92 Kb
TOTAL
100%
1.09 Mb
Requests by domain
Domain
Percent
Requests
washing-machine-customer-care.in
93.9 %
31
googletagmanager.com
3.0 %
1
google-analytics.com
3.0 %
1
TOTAL
100%
33
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE php>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 55
Failed: 5
Warnings: 0
Passed: 4
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
Server: Microsoft-IIS/8.5
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 55
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: http://www.washing-machine-customer-care.in is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="http://www.washing-machine-customer-care.in" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:secureserver.net -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved