seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://www.themodernhouse.xyz
Your general SEO Checkup Score
Archived
71/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 71 out of 100, which is below the average score of 75. However, there are 11 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
11 Failed
0 Warnings
41 Passed
Common SEO issues
Score: 71
Failed: 4
Warnings: 0
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: - Just another WordPress site
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Just another WordPress site
Google Search Results Preview Test
Desktop version
https://www.themodernhouse.xyz- Just another WordPress siteJust another WordPress site
Mobile version
https://www.themodernhouse.xyz- Just another WordPress siteJust another WordPress site
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
10published10march10categorized10tagged9kitchen
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
accomplishedaidsalliedamericanappalledappeararchitectarchitectsarchitecturearchsmarterbasementbuildingcabinetrycabinetscategorizedcawrsechagrincheapclosedconsultantscontentcontinuingcouplecraigcupboardcustomercustomizationsdatedesigndiamonddirectoreastelementsfallsfarmhousefashionablefireplaceforwardfuturegoinggreatestgreenhardesthelphomehousehundredsideaideasindicatorindonesiainitiativesinspirationsinstituteintentionsissuesjavajustkenjerankitchenlikedmakemakersmarchmultifamilyofferofferedonlineorderorganizationalpackagespanoramaperformanceplansproducersprojectprojectspublishedquiterecentremodelresidenceroomsaidsatisfiedservedservicesiteskipstoragestructurestyletaggedtowntransformedtrendytrumpwordpressworkworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Architecture
Packages & Initiatives
Greatest 15 Cabinetry And Cupboard Makers In Kenjeran, East Java, Indonesia
Customer Help
The Way Forward For Multifamily Design
Trendy Farmhouse Was The Most Well-liked Residence Style Of 2020
Dwelling Rooms
Fashionable & Up To Date Fireplace Producers
Trendy Basement Ideas (design Guide)
Green Building
Why Train With Dataversity
One Hundred Twenty Basement Remodel Ideas & Inspirations
Colourful Flooring In A Basement Household Room
Home Plans
What’s Going To The Architect Of The Future Appear To Be? Archsmarter
Examples Of Parasitic Architecture Around The World
Cheap Kitchen Cabinets Online
Sauder Homeplus Four Shelf Storage Cabinet
Recent Posts
Recent Comments
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage doesn't use "img" tags.
Inline CSS Test
  • Congratulations! Your webpage is not using any inline CSS styles.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 59
Failed: 5
Warnings: 0
Passed: 11
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 6.15 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 24.96 Kb to 6.15 Kb (75% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 0.59 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Total Objects: 9
  • 1 HTML Pages
  • 4 CSS Files
  • 4 JS Files
  • 0 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 44
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.themodernhouse.xyz is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.themodernhouse.xyz/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:68.65.121.182 include:spf.web-hosting.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved