seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.thehearingcentre.sg
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 87 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
6 Warnings
59 Passed
Issues to fix
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 79
Failed: 2
Warnings: 4
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 61 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Best hearing aids providers in Singapore | The Hearing Centre
Length: 61 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 132 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: The Hearing Centre is an award-winning hearing aids provider in Singapore with over 20+ years of experience and over 10000+ clients.
Length: 132 characters
Google Search Results Preview Test
Desktop version
https://www.thehearingcentre.sg/Best hearing aids providers in Singapore | The Hearing CentreThe Hearing Centre is an award-winning hearing aids provider in Singapore with over 20+ years of experience and over 10000+ clients.
Mobile version
https://www.thehearingcentre.sg/Best hearing aids providers in Singapore | The Hearing CentreThe Hearing Centre is an award-winning hearing aids provider in Singapore with over 20+ years of experience and over 10000+ clients.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Best hearing aids providers in Singapore | The Hearing Centre
og:description
The Hearing Centre is an award-winning hearing aids provider in Singapore with over 20+ years of experience and over 10000+ clients.
og:url
https://www.thehearingcentre.sg/
og:site_name
Hearing Aids Singapore
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
80hearing36aids15branch9centre9best
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
hearing
aids
branch
centre
best
Keywords Cloud Test
adjustmentsaidsanalogassraudiometryawardawardsbackgroundbasicbatterybestbetterbranchbrandsbusinessbuttoncanalcarecentercentrecommitmentcommoncomponentscontactconvertedcustomerdeafnessdeliversdigitalemailexperienceexpertisefamilyfaqsfittingfreehavehearhearinghelphomeimplantsimprovelifelifestyleloginlossmainmarketmeasurementsmembermembersmicrophonemythsnoisenovemberonesonlineoutstandingpartnershippatientspeoplephonakpostpowerprocessorproductsprovideproviderprovidingpurequalityreadreceiverrepairsresoundreviewsrightsatisfactionsearchserviceservicessigniasingaporesophisticatedsoundsourcestarkeystrivetechnologytermstesttestimonialsteststonetympanometryusuallyvisionworldyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Quality Hearing Aids Provider in Singapore
H2 tags
What We Provide
Our Recognition, Achievements and Awards
Outstanding Business Partnership Award (2020)
Trailblazer Award (2019)
Outstanding Audiology Practice (2018-2019)
Best In Customer Satisfaction (2016-2018)
Best In Success Rate In Fitting (2016-2018)
Outstanding Business Partnership Awards (2014)
Our Trusted Partners
Unsurpassed Passion and Commitment to Overcome Hearing Loss
Satisfaction Guarantee – Our Customer Testimonials
Revelation of the Wonders of Hearing Aids
Basics of Hearing Aids
The microphone picks up the sounds in the environment and passes them to the processor.
The processor enhances the signal and delivers it to the receiver
The receiver delivers the amplified sound to the ear canal.
The power source refers to the battery, which drives the hearing aids system.
Latest Blog
7 Common Myths About Hearing Aids
Best Hearing Aids and Brands In The Market
Find a clinic near you
Call for an appointment!
Newsletter Subscription
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 91
Failed: 2
Warnings: 1
Passed: 22
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 810 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 265.54 Kb to 56.84 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.34 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
font
63.0 %
499.08 Kb
image
29.4 %
232.65 Kb
html
7.6 %
60.05 Kb
css
0.0 %
0 B
javascript
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
791.78 Kb
Requests by content type
Content type
Percent
Requests
image
46.4 %
13
font
46.4 %
13
html
7.1 %
2
css
0.0 %
0
javascript
0.0 %
0
other
0.0 %
0
TOTAL
100%
28
Content size by domain
Domain
Percent
Size
cdn-cjgkh.nitrocdn.com
76.4 %
604.54 Kb
fonts.gstatic.com
9.5 %
75.48 Kb
thehearingcentre.sg
7.5 %
59.61 Kb
img.youtube.com
6.5 %
51.71 Kb
to.getnitropack.com
0.1 %
459 B
TOTAL
100%
791.78 Kb
Requests by domain
Domain
Percent
Requests
cdn-cjgkh.nitrocdn.com
67.9 %
19
fonts.gstatic.com
14.3 %
4
img.youtube.com
10.7 %
3
thehearingcentre.sg
3.6 %
1
to.getnitropack.com
3.6 %
1
TOTAL
100%
28
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.470 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.47 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.015 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.015 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.33 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.33 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<rs-module-wrap id="rev_slider_1_1_wrapper" data-source="gallery" style="background: transparent; padding: 0px; margin: 0px..." class="nitro-stretch lazyloaded">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0003. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0003

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0003
Server and security
Score: 86
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.thehearingcentre.sg" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
thehearingcentre.sg
Subject Alternative Names (SANs)
*.thehearingcentre.sg, thehearingcentre.sg
Not valid before
Fri, September 29o 2023, 1:39:46 am (z)
Not valid after
Thu, December 28o 2023, 1:39:45 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.thehearingcentre.sg/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.thehearingcentre.sg/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved