seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.steigerplankenmeubels.nl
Your general SEO Checkup Score
Archived
66/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 66 out of 100, which is below the average score of 75. However, there are 16 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
16 Failed
1 Warnings
32 Passed
Common SEO issues
Score: 69
Failed: 5
Warnings: 0
Passed: 15
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Noël van Breugel | Maatwerk in steigerplanken meubels
Meta Description
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview
Desktop version
https://www.steigerplankenmeubels.nlNoël van Breugel | Maatwerk in steigerplanken meubels
Mobile version
https://www.steigerplankenmeubels.nlNoël van Breugel | Maatwerk in steigerplanken meubels
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
7voor5niet4projecten4steigerplanken4alleen
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
aangepastadviseerafgewerktaircoallealleenallesaltijdbekijkbepalenbestebijnabinnenbladenbreugelbuitencompletecontactdezeeikeneindresultaatelectrapuntenfactureergebrachtgebruiktegedroogdegeheleglazengrenenhebthiervanhomehoutietsimitatieindelingindienkaleklantkleurenklikkoelingenkortekrimpenkunnenkunststofleukleverlijnenmaarmaatwerkmakenmeermeubelmeubelsmoetmogelijknaarnavigationnietnodignoëloffreeromdatonderontwerpovenplaatsplaatseplaatsenplankenpositiesproductieprojectenrealisatierottenruimteschroefsoortenstandaardsteigerhoutsteigerhoutensteigerplankentekentevenstijdensverlichtingvindvitrinesvochtpercentagevoorvoorstellenvurenwerkwordenzaagzelfzelfszijnzoeken
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Noël van Breugel
H2 tags
Maatwerk in steigerplanken meubels
Van ontwerp tot realisatie
Als het van hout is kan ik het voor u maken
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage doesn't use "img" tags.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 32
Failed: 7
Warnings: 1
Passed: 5
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 30.65 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 75% - from 30.65 Kb to 7.77 Kb .
Site Loading Speed Test
  • Your website loading time is around 7.64 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 28
  • 1 HTML Pages
  • 5 CSS Files
  • 16 JS Files
  • 6 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 0
Failed: 4
Warnings: 0
Passed: 3
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage use the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
See results list
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.steigerplankenmeubels.nl/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.steigerplankenmeubels.nl/" rel="canonical"/>
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved