seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://www.standaard.be
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 104 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
3 Warnings
39 Passed
Common SEO issues
Score: 75
Failed: 2
Warnings: 2
Passed: 13
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: De Standaard
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Het meest recente nieuws uit België en het buitenland, economie en geld, cultuur, sport en lifestyle. Lees online de krant en DS Avond.
Google Search Results Preview Test
Desktop version
https://www.standaard.beDe StandaardHet meest recente nieuws uit België en het buitenland, economie en geld, cultuur, sport en lifestyle. Lees online de krant en DS Avond.
Mobile version
https://www.standaard.beDe StandaardHet meest recente nieuws uit België en het buitenland, economie en geld, cultuur, sport en lifestyle. Lees online de krant en DS Avond.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
49lees49verder23voor17niet14zijn
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
aalstabonnementaccountakkoordalleenarabiëavondbekijkbeleggingsclubbelgischebelgiëblijftborisbrexitbritsebuitenlandcarnavalcorbyndartsdealdoetdoodeersteeuropaeuropeseformatiefrankgaatgeengoedgoedehaarheefthermanietsinvloedjaarjamaicajarigejeremyjobsjohnsonkerstmiskindklantendienstklimaattopkrantlabourlatenleesmaandmadridmeermeestmensenmijnmissmoetnaarnietnieuwnieuwenieuwsnooitolieverslavingonderonzeopenopiniesoverzichtparlementraadrompuyrousseausamensaudisorrystandaardtegentrumptweevanafveelverandertverdervideovolgensvoorvoorzittervragenvrouwwebshopweekwerdweverwordenworldzichzijnzwak
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Klimaattop Madrid baart een vaag compromis-akkoord
De Wever: ‘Ik beloofde Open VLD en CD&V dat ik hen nooit zou laten vallen’
Opgejaagde drugscrimineel ensceneert opnieuw eigen dood
21-jarige onder invloed rijdt tiener dood: ‘Ik wist dat ik “iets” geraakt had’
Nouvelle vague-icoon Anna Karina overleden
Kunstenaar Koen Vanmechelen na dood van zijn vrouw: ‘Ons hele leven samen was magie’
Open VLD wil werkzoekenden in flexi-jobs: ‘Als opstap naar volwaardige job’
Parbleu | Vlaams klimaatproject creëert schokeffect
Vier jongeren zwaargewond na ongeval op E17
Jeremy Corbyn excuseert zich bij Labour-kiezers na historische nederlaag: ‘Het was een onaflatende lastercampagne’
Ben ik extra vatbaar voor een burn-out?
Veertiger ligt al maand dood in appartement
Gezocht: voorzitter voor matig rendabele staatsbank
Dodentol stijgt tot 16 na vulkaanuitbarsting op Nieuw-Zeeland
Herman Van Rompuy over formatie: ‘De Wever ademt machteloosheid uit’
Slapende Tesla-bestuurder gespot op autosnelweg
Kobe Desramaults rondt af in Gent en wil graag naar buitenland
De 50 beste Belgische songs van het decennium
De grote versimpeling: van Brexit tot Vlexit
Finse minister zegt sorry voor Instagram-poll over IS-vrouwen
‘Misschien loopt het niet goed af. En wat als dat oké is?’
Greta Thunberg: 'Ik heb nood aan vakantie'
Man hackt beveiligings-camera in kamer achtjarig meisje: 'Ik ben de Kerstman'
Golven vol plastic flessen spoelen aan op Zuid-Afrikaans strand
‘Vlaanderen dreigt het Wallonië van Europa te worden’
Cercle Brugge doet zichzelf de das om en blijft alleen laatste
Gentse wijkorganisaties willen Roma kleinschaliger en op maat begeleiden
Getreuzel Jeremy Corbyn na verkiezings-nederlaag wekt woede op
Treinen rijden volgens nieuwe dienstregeling: dit verandert er
Tienduizenden ‘Sardienen’ protesteren in Rome
‘Als kind kun je toch moeilijk vragen: spuit mijn moeder dood?’
‘Wapenleveranciers Jemen moeten veroordeeld worden’
Eerst nog regen, later droog
Saudi-Arabië kickt af van zijn olieverslaving
Israël ‘tevreden’ dat carnaval Aalst van Unesco-lijst verdwijnt
De mini-Trumps van de Amerikaanse diplomatie
Nieuwe Xbox-console krijgt ongewoon design
Kroontje Miss World naar Jamaica, België al snel uitgeschakeld
Als de vrouw de broek koopt (en de man ze draagt)
Fien Germijns: ‘Bij Stubru doet het er niet toe wat je gestudeerd hebt’
Hoe zelfs de dood van een kind niets verandert aan ‘realpolitik’, koning Filip de Wetstraat verrast en Open VLD kraakt
5 reisberlines met een benzinezescilinder voor minder dan 5.000 euro
21-jarige onder invloed van drank en drugs rijdt tiener dood: ‘Ik wist dat ik “iets” geraakt had’
Conner Rousseau legt in maidenspeech als partijvoorzitter uit hoe hij SP.A wil hervormen
Machtscentrum van EU werd met zwartwerk en illegale arbeid gebouwd
Blijf ik thuis voor de studerende kinderen?
Boris Johnson wil Brits parlement nog vóór Kerstmis over Brexit-deal laten stemmen
Rousseau mag als SP.A-voorzitter in parlement blijven
De eenzaamheid van ouderen op het platteland
Hoeveel verdient een freelance SEO specialist?
We zeggen te vaak sorry op de werkvloer
Zo herken je een goede boekhouder
Eén op vier vindt mensen die slecht spellen dommer
Cartoon van de dag - december 2019
Emma Watson en Kristen Stewart in de huid van Juliet voor Pirelli-kalender
Frank Gehry opnieuw in zee met Louis Vuitton
Britse modeprijzen uitgereikt, zij schitterden op de rode loper
Queen haalt kerstversiering boven
Lior Refaelov bezorgt Antwerp zuinige zege tegen Eupen
Belgische sensatie op WK darts: Kim Huybrechts verslaat oud-wereldkampioen
Ria Van Landeghem neemt revanche voor een ontstolen carrière
Zulte Waregem veegt de vloer aan met zwak STVV
Racing Genk fluitend voorbij zwak Waasland-Beveren
Homeopathie voor beginners
Handelsoorlog of niet, ‘Belgische uitvoer naar VS sterk gestegen’
Belgische wafels nieuw wapen in handelsoorlog
China en VS sluiten eerste deal na anderhalf jaar handelsconflict
Beleggingsclub Nooit Gedacht gaat naar de cinema
Geef je interieur virtueel vorm met deze 10 gratis online tools
Erfgoed om in te wonen
‘Een signaal om dringend te renoveren’
‘Pariaprins’ werpt schaduw over huwelijk oudste dochter
Emily Ratajkowski heeft boodschap voor Weinstein
Tweesterrenrestaurant ’t Zilte verhuist naar nieuwe locatie (al is het niet ver)
Onze recensent ontdekte de eerste pizzeria die ook een goede wijnkaart heeft
Man hackt beveiligingscamera in kamer van achtjarig meisje: 'Ik ben de Kerstman'
Storm legt duizenden ‘penisvissen’ bloot
Boris Johnson bedankt Elmo en Lord Buckethead
Donald Trump junior schiet zeldzaam schaap dood in Mongolië
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 76
Failed: 3
Warnings: 1
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 235.45 Kb to 33.42 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 5.75 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 163
  • 6 HTML Pages
  • 4 CSS Files
  • 52 JS Files
  • 101 Images
  • 0 Flash Files
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Your webpage is not using uncached JavaScript resources from your domain.
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 6
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved