seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://www.spiraxsarco.ch
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 109 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
2 Warnings
27 Passed
Common SEO issues
Score: 81
Failed: 1
Warnings: 1
Passed: 10
Google Search Results Preview
Desktop version
http://www.spiraxsarco.com/pages/home.aspx Home | Spirax Sarco International Spirax Sarco is synonymous with excellence in steam system engineering. We create solutions that set the benchmark for steam-Using organisations worldwide. We have a strong global presence with 51 operating companies in 34 countries.
Mobile version
http://www.spiraxsarco.com/pages/home.aspx Home | Spirax Sarco International Spirax Sarco is synonymous with excellence in steam system engineering. We create solutions that set the benchmark for steam-Using organisations worldwide. We have a strong global presence with 51 operating companies in 34 countries.
Keywords Cloud
africaamericaauditbelgiumbenefitsboilercapabilitiescenter:;dialogheight:;dialogwidth:;resizable:yes;status:no;location:no;menubar:no;help:nochilechinacolombiacomplianceconfigconnectorscontenttypeczechdanmarkdenmarkdetailseasteasyefficiencyenergyespañaexpertiseexpertisesolutionssustainabilityexplorefalsefalse;}false;}}fasterfinlandfunctionglobalgotopageafterclose(pageid){if(pageidholdhungary(magyarországif(pageidindiaindonesiajavascript:commonshowmodaldialog('{siteurl}/_layouts/itemexpiration.aspx?id={itemid}&list={listid}kingdomlines.findlivelocallowermaintainmaintenancemonitoringnederlandsnewsnullofferpipelinepresenceproductsprovidequickreplacereplacementrepublicresourcesreturnsarcoschweizservicessingaporesingapurasolutionssouthspainspiraxstatessteamsuissesverigesvizzeraswedenswitzerlandtaiwanthailandtraptrapsturkeyturntürkiyeukraineunderstandunitedvietnamwateryou.find{stsnavigate(unescape(decodeuri('{siteurl}'))+'/_layouts/expirationconfig.aspx?id={itemid}&list={listid}{stsnavigate(unescape(decodeuri('{siteurl}'))+'/_layouts/hold.aspx?id={itemid}&list={listid}{stsnavigate(unescape(decodeuri('{siteurl}'))+'/_layouts/reporting.aspx?category=auditing&backtype=item&id={itemid}&list={listid}ČeskoУкраїнаประเทศไทย中国台灣
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage has 120 'img' tags and 7 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • We found some HTML deprecated tags. Your are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Speed optimizations
Score: 66
Failed: 2
Warnings: 1
Passed: 2
HTML Page Size Test
  • Congratulations! Your HTML size is 25.31 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 102.56 Kb to 25.31 Kb (75 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 25.92 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 120
  • 3 HTML Pages
  • 8 CSS Files
  • 20 JS Files
  • 89 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Server and security
Score: 20
Failed: 2
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 75
Failed: 1
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2026 • All rights reserved