seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.souhalahwal.tn
Your general SEO Checkup Score
Archived
75/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 75 out of 100, which is the same as the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
5 Warnings
55 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Cumulative Layout Shift score of 0.1 or less.
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 54
Failed: 6
Warnings: 4
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 7 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Best of
Length: 7 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 90 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Search results for adsense, We look forward to showing you your sales performance software
Length: 90 characters
Google Search Results Preview Test
Desktop version
https://www.souhalahwal.tn/Best ofSearch results for adsense, We look forward to showing you your sales performance software
Mobile version
https://www.souhalahwal.tn/Best ofSearch results for adsense, We look forward to showing you your sales performance software
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Best of
og:url
https://www.souhalahwal.tn/
og:site_name
Best of
og:type
website
og:description
Search results for adsense, We look forward to showing you your sales performance software
og:image:alt
Best of
og:image
Add_your_image_url_here
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
8blogger6menu6المشاهدات6adsense5best
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
blogger
menu
المشاهدات
adsense
best
Keywords Cloud Test
acceptadsensebathingbestblogbloggerbrowsingcitycontactculturedynamicsemergesenablegoldengooglehorizonicloudindustryinternetjavascriptjourneykarachilandinglargestmenumetametropolismodenotificationonlinepagepinnedpopularpostpostsproductrobotssafelinksearchedsitesitemapsprawlingstunningtemplatetextsthemevisualwindowswordsإضافةارتفاعاكوادالأحدالأعلىالأنترنتالاحدالاكوادالبرامجالبلادالتونسيةالجويالحمايةالربحالرصدالطقسالفيسبوكالمدونةالمشاركاتالمشاهداتالمعلومياتالمقالاليومباردبلوجرتأثيرتحليلتشهدتعملتهتمتوقعاتتونسجديدشروحاتصحيحةعالملاحظتلليومليوممدونةمصورةملاحضةمنخفضمواضيعمولدنسبيوأخباروحلقاتيؤدييمينكيوجد
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Best of
H2 tags
Pinned Post
آخر المشاركات
توقعات الطقس ليوم الاحد 4 اوت
Karachi's Stunning Visual Journey
A City of Industry and Culture
Most searched words on Google
Blogger template to accept AdSense
The Dynamics of Blogger AdSense
Categorised Posts
Popular Posts
Labels
Best OF
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 80
Failed: 4
Warnings: 0
Passed: 21
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,163 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 317.26 Kb to 71.77 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 10.79 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
javascript
64.8 %
257.96 Kb
html
16.7 %
66.35 Kb
image
8.0 %
32.03 Kb
font
7.4 %
29.63 Kb
other
3.1 %
12.29 Kb
css
0.0 %
0 B
TOTAL
100%
398.27 Kb
Requests by content type
Content type
Percent
Requests
image
38.5 %
5
javascript
30.8 %
4
font
15.4 %
2
html
7.7 %
1
other
7.7 %
1
css
0.0 %
0
TOTAL
100%
13
Content size by domain
Domain
Percent
Size
pagead2.googlesyndication.com
66.2 %
263.60 Kb
souhalahwal.tn
16.9 %
67.47 Kb
blogger.googleusercontent.com
7.8 %
30.89 Kb
fonts.gstatic.com
7.4 %
29.63 Kb
tpc.googlesyndication.com
1.7 %
6.67 Kb
TOTAL
100%
398.27 Kb
Requests by domain
Domain
Percent
Requests
pagead2.googlesyndication.com
38.5 %
5
blogger.googleusercontent.com
23.1 %
3
souhalahwal.tn
15.4 %
2
fonts.gstatic.com
15.4 %
2
tpc.googlesyndication.com
7.7 %
1
TOTAL
100%
13
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.422 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.422 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.188 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.188 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.19 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.19 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: إضافة عدد المشاهدات في مواضيع بلوجر ملاحضة كل الاكواد في هذا المقال صحيحة و تعمل...
Html: <div class="pSnpt">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.2574. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.2574

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Pinned Post إضافة عدد المشاهدات في مواضيع بلوجر إضافة عدد المشاهدات في مواضيع بل...
Html: <div class="blogM" style="height: auto !important;">
Score: 0.2462
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.souhalahwal.tn" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.souhalahwal.tn
Subject Alternative Names (SANs)
www.souhalahwal.tn
Not valid before
Sat, June 29o 2024, 6:16:12 am (z)
Not valid after
Fri, September 27o 2024, 7:05:23 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
WR3
Intermediate certificate
Common name
WR3
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, user-scalable=1, minimum-scale=1, maximum-scale=5" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.souhalahwal.tn/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.souhalahwal.tn/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but it contains duplicated or invalid records! These warnings highlight points of concern which should not affect the processing of the authorized sellers list, but which should be resolved as soon as possible.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved