seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://www.primaflorafloristaccrington.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 111 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
0 Warnings
58 Passed
Common SEO issues
Score: 85
Failed: 3
Warnings: 0
Passed: 19
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Accrington Florists - Flower Delivery by Prima Flora Flower Shop
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Prima Flora, Accrington florists in Lancashire for flower delivery of beautiful flowers from our local flower shop. Wedding & funeral flowers
Google Search Results Preview Test
Desktop version
https://www.primaflorafloristaccrington.co.ukAccrington Florists - Flower Delivery by Prima Flora Flower ShopPrima Flora, Accrington florists in Lancashire for flower delivery of beautiful flowers from our local flower shop. Wedding & funeral flowers
Mobile version
https://www.primaflorafloristaccrington.co.ukAccrington Florists - Flower Delivery by Prima Flora Flower ShopPrima Flora, Accrington florists in Lancashire for flower delivery of beautiful flowers from our local flower shop. Wedding & funeral flowers
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_GB
og:type
website
og:title
Accrington Florists - Flower Delivery by Prima Flora Flower Shop
og:description
Prima Flora, Accrington florists in Lancashire for flower delivery of beautiful flowers from our local flower shop. Wedding & funeral flowers
og:url
https://www.primaflorafloristaccrington.co.uk/
og:site_name
Prima Flora
og:image
https://www.primaflorafloristaccrington.co.uk/wp-content/uploads/2022/04/Flower-Shop-of-Prima-Flora-Florist-Accrington-e1650631203349.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
21flowers14flower14accrington9delivery9mobile
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accringtonalternativelyaquaaquasareaareasarrangementsavailablebeautifulbespokeblogbouquetbouquetsboxedcarechooseclickcolourscontactcontentcovidcreatedelivereddeliverydirectlyexitfacebookflorafloristfloristsflowerflowersfreshfuneralgiftgooglehandhavehearthomeimageimagesjustkindknowlancashirelargerleaveleftlikelocallongerlookinglowermainmakemenumobilemothernationwideoccasionsofferorderpageplacepolicypostpreferredpreviousprimaproviderelayreputablereviewsrightrosesselectionserviceshareshopskilledskipswipesympathyteddytelefloratiedtipstoggletributestrulyuniqueupdateusingvalentineviewvisitweddingwonderfulworldwide
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Congratulations! Your webpage contains headings tags.
H1 tags
Accrington Florists for Delivery of Beautiful Gift, Wedding & Funeral Flowers from our Local Flower Shop
H2 tags
Prima Flora for Same Day Flower Delivery of Beautiful Flowers in the Accrington Area
Google & Facebook Reviews for Prima Flora.
Gift Flowers – Hand tied bouquets & aquas.
Weddings
Funeral & Sympathy Tributes
Need to Know More About Our Florists?
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 92
Failed: 1
Warnings: 0
Passed: 14
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 968 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 268.85 Kb to 38.24 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 0.55 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Content size by content type
Content type
Percent
Size
javascript
41.8 %
97.03 Kb
image
37.1 %
86.03 Kb
html
15.5 %
35.94 Kb
css
4.1 %
9.43 Kb
font
1.6 %
3.67 Kb
other
0.0 %
0 B
TOTAL
100%
232.10 Kb
Requests by content type
Content type
Percent
Requests
image
50.0 %
10
javascript
30.0 %
6
css
10.0 %
2
html
5.0 %
1
font
5.0 %
1
other
0.0 %
0
TOTAL
100%
20
Content size by domain
Domain
Percent
Size
primaflorafloristaccrington.co.uk
100.0 %
232.10 Kb
TOTAL
100%
232.10 Kb
Requests by domain
Domain
Percent
Requests
primaflorafloristaccrington.co.uk
100.0 %
20
TOTAL
100%
20
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.primaflorafloristaccrington.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
sni.cloudflaressl.com, primaflorafloristaccrington.co.uk, *.primaflorafloristaccrington.co.uk
Not valid before
Sun, July 11o 2021, 12:00:00 am (z)
Not valid after
Sun, July 10o 2022, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 59
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.primaflorafloristaccrington.co.uk is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.primaflorafloristaccrington.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:_spf.mx.cloudflare.net ~all
Ads.txt Validation Test80% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved