seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://www.perlen-korallen.de
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 102 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
3 Warnings
57 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 88
Failed: 2
Warnings: 1
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Perlenschmuck und Korallenschmuck direkt vom Hersteller
Length: 55 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Perlenschmuck und Korallenschmuck direkt vom Hersteller in Handarbeit garantiert vom Fachmann gefertigt zu einen fairen Preis und einer hohen Qualität.
Length: 151 characters
Google Search Results Preview Test
Desktop version
https://www.perlen-korallen.de/Perlenschmuck und Korallenschmuck direkt vom HerstellerPerlenschmuck und Korallenschmuck direkt vom Hersteller in Handarbeit garantiert vom Fachmann gefertigt zu einen fairen Preis und einer hohen Qualität.
Mobile version
https://www.perlen-korallen.de/Perlenschmuck und Korallenschmuck direkt vom HerstellerPerlenschmuck und Korallenschmuck direkt vom Hersteller in Handarbeit garantiert vom Fachmann gefertigt zu einen fairen Preis und einer hohen Qualität.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
16daten13werden11perlen11diese10perlenschmuck
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
daten
werden
perlen
diese
perlenschmuck
Keywords Cloud Test
akoyaperlenakzeptierenalleandereangegebenenanlassaufbewahrungsfristbenötigtcookiesdatendatenschutzerklärungdienstdienstesdienstleistungendiesedieserdirektdsgvodurchechteechtenechterecwidedelsteineeineeinwilligungeleganzentdeckenexklusivenfertigengelöschtgespeichertglanzgooglegrundlagehandarbeitherstellerhierhochwertigehochwertigenhttpsihreihrenihrerimitationsperlenjapanischejedenklickenkontaktkorallekorallenkorallenschmuckköniginlavalesenlistemapsmehrmuschelkernperlennatürlichenatürlichennichtoderonlineperlenperlenschmuckperlenshopperlenwissenprivacyrechtlicheschmuckschmuckstückeschmuckwerkstattschönheitsearchsehenservicesichsindsobaldspringenstelltsüßwasserperlentahitiperlentechnologientoggleunserenunterverarbeitetverarbeitungverarbeitungszweckeverwendetvielenvulkangesteinwebsitewennwerbungwerdenzeitloserzwecke
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Perlenschmuck und Korallenschmuck direkt vom Hersteller
H2 tags
Perlenschmuck – Zeitloser Schmuck aus echten Perlen
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 82
Failed: 4
Warnings: 1
Passed: 15
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 605 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 300.2 Kb to 44.34 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.24 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
37.9 %
368.26 Kb
css
35.9 %
348.50 Kb
image
14.6 %
142.22 Kb
font
7.2 %
69.63 Kb
html
3.9 %
37.96 Kb
other
0.5 %
4.37 Kb
TOTAL
100%
970.95 Kb
Requests by content type
Content type
Percent
Requests
javascript
39.6 %
19
image
33.3 %
16
css
12.5 %
6
html
6.3 %
3
font
4.2 %
2
other
4.2 %
2
TOTAL
100%
48
Content size by domain
Domain
Percent
Size
perlen-korallen.de
55.7 %
541.19 Kb
d34ikvsdm2rlij.cloudfront.net
16.0 %
155.65 Kb
d1oxsl77a1kjht.cloudfront.net
11.7 %
113.95 Kb
d3cy3u1txmkqs3.cloudfront.net
7.6 %
74.01 Kb
djqizrxa6f10j.cloudfront.net
3.7 %
36.17 Kb
ecwid-addons.s3.amazonaws.com
2.8 %
27.29 Kb
d1howb1wwyap5o.cloudfront.net
1.3 %
12.82 Kb
app.ecwid.com
0.8 %
7.46 Kb
cdn.pagepulse.info
0.2 %
1.88 Kb
api.pagepulse.info
0.1 %
545 B
TOTAL
100%
970.95 Kb
Requests by domain
Domain
Percent
Requests
perlen-korallen.de
56.3 %
27
d34ikvsdm2rlij.cloudfront.net
10.4 %
5
d1howb1wwyap5o.cloudfront.net
8.3 %
4
app.ecwid.com
6.3 %
3
djqizrxa6f10j.cloudfront.net
6.3 %
3
ecwid-addons.s3.amazonaws.com
4.2 %
2
cdn.pagepulse.info
2.1 %
1
api.pagepulse.info
2.1 %
1
d1oxsl77a1kjht.cloudfront.net
2.1 %
1
d3cy3u1txmkqs3.cloudfront.net
2.1 %
1
TOTAL
100%
48
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.210 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.21 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.282 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.282 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.65 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.65 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Perlenschmuck und Korallenschmuck direkt vom Hersteller
Html: <h1 style="text-align:center">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0092. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0092

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div class="section-inner section-edge18Inner" data-styled-section-id="7b6a7d94-4059-4118-80a2-083d1cfd31da">
Score: 0.0090
Server and security
Score: 86
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.perlen-korallen.de" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.perlen-korallen.de
Subject Alternative Names (SANs)
*.perlen-korallen.de, perlen-korallen.de
Not valid before
Wed, March 19o 2025, 12:00:00 am (z)
Not valid after
Thu, March 19o 2026, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.perlen-korallen.de/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.perlen-korallen.de/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf-eu.ionos.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved