seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.pctuts.be
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 127 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
3 Warnings
25 Passed
Common SEO issues
Score: 79
Failed: 1
Warnings: 2
Passed: 10
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Hulp bij internet en computer problemen.
Google Search Results Preview
Desktop version
https://www.pctuts.beComputerhulp - Hulpforum PctutsHulp bij internet en computer problemen.
Mobile version
https://www.pctuts.beComputerhulp - Hulpforum PctutsHulp bij internet en computer problemen.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
36berichten34topics34windows31gepost31door
Keywords Cloud
afspelenallesandroidantwoordasusbekijkenberichtenbestrijdtbesturingssystemenbranderbrandweercalifornicollapsecomputerdaardoordownloadendvdramelektrischeenkelefirmwareforumforumsfoutfreewaregamesgebruikgeengepostgisterengmailgratisguaonhardwareheeftherstelpuntenhierhl-td-sthulpiemandintelinternetkwijtlaatstelaptopmaaktmakenmeermijnmisschiennaarnietnieuwenieuwsnintendoondanksoverigeplaatsenpostsprobleemproblemenprocessorsprogrammaqtexrufusschijfsimpelskippysoftwarestaatstartstelstroomkabelsub-forumstesla-fabriektipstochtopicstrucstubetutorialsupdatevaltvandaagvariavindenvistavoertuigenvolgensvoorvorigevraagvragenvuurwaarwindowswordenx750lnzeggenzonder
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Aankondiging
Computerhulp
Hulpforum Pctuts statistieken
Login
Laatste Berichten
Laatste onderwerpen
trending
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
Speed optimizations
Score: 73
Failed: 2
Warnings: 1
Passed: 3
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 20.53 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 161.61 Kb to 20.53 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Page Objects
Total Objects: 49
  • 5 HTML Pages
  • 16 CSS Files
  • 9 JS Files
  • 19 Images
  • 0 Flash Files
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Congratulations! Your website's CSS files are minified!
See results list
URL Redirects Checker
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 0
URL Canonicalization Test
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 1
Warnings: 0
Passed: 3
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.pctuts.be is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.pctuts.be" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved