seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://www.opusm.ch
Your general SEO Checkup Score
Archived
75/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 75 out of 100, which is the same as the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
1 Warnings
30 Passed
Common SEO issues
Score: 67
Failed: 4
Warnings: 1
Passed: 10
Google Search Results Preview
Desktop version
http://www.opusm.ch/OPUSm – Mobile ServicelösungenOPUSm AG optimierte mobile Businessprozesse. Unsere Lösungen helfen Unternehmen, die Daten aus Ihren Backendsystemen auf beliebige mobile Geräte zu bringen, um dadurch die Produktivität Ihrer externen Mitarbeiter zu steigern. Unter den vielfältigen Einsatzmöglichkeiten unserer Lösungen bieten gerade Service- und Instandhaltungsabläufe ein sehr interessantes Optimierungspotential, die kürzeste Pay-back Zeiten versprechen.
Mobile version
http://www.opusm.ch/OPUSm – Mobile ServicelösungenOPUSm AG optimierte mobile Businessprozesse. Unsere Lösungen helfen Unternehmen, die Daten aus Ihren Backendsystemen auf beliebige mobile Geräte zu bringen, um dadurch die Produktivität Ihrer externen Mitarbeiter zu steigern. Unter den vielfältigen Einsatzmöglichkeiten unserer Lösungen bieten gerade Service- und Instandhaltungsabläufe ein sehr interessantes Optimierungspotential, die kürzeste Pay-back Zeiten versprechen.
Keywords Cloud
abgelegtallealleinealleranlaufarbeitetauchautomatischbegeisternberichtebleibtcopyrightdarumdatendenndennochdigitaledigitalisierungdurcheffizienzeineeinem mausklickeinfacheeinsatzerfolgerfolgterhaltenerplösungerstenerwartenfliegtfürgeübtglobalehabenihnenihreihrerimpressuminformationeninternenitmanagerjahrejederkeinkompetentkostenkundenkönnenmastermeistmeldenmillionenbudgetmitbewerbernichtoderopusmpaybackzeitplanungqualitätraketereduziertrelevantenschnellschonseinserviceserviceadministrationserviceauftragserviceeinsatzservicelösungservicemitarbeitendenservicepartnerserviceprozesseservicetechnikersichsindsolangespesensystemvielfalttransformationentransparenzumsounternehmenverbesserungsvorschlägeverkaufschancenvorbereitetwartenweilweiterleitungwerdenwichtigwichtigerwirdwollenxfachzugriffzurückzuverlässigüber
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage has 14 'img' tags and 6 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 26 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 65
Failed: 4
Warnings: 0
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 70.56 Kb to 14.19 Kb (80 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 5.275 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 34
  • 1 HTML Pages
  • 16 CSS Files
  • 2 JS Files
  • 15 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and jpcache. Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 80
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page is using the canonical link tag. This tag specifies that the URL: http://www.opusm.ch is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel="canonical" href="http://www.opusm.ch/" />
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 include:spf.protection.outlook.com -all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved