seo site checkup logo
PricingFree ToolsArticles
Report generated 6 months ago
https://www.olesentuition.co.uk
Your general SEO Checkup Score
Archived
81/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 81 out of 100, which is higher than the average score of 75. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
7 Warnings
56 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 69
Failed: 3
Warnings: 5
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 61 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: German Lessons in London and Online with Expert Native Tutors
Length: 61 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 147 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Learn German with the top-rated German language school. ✓Qualified Native Tutors ✓1:1 German Lessons ✓Small German Classes ✓25+Years of Experience.
Length: 147 characters
Google Search Results Preview Test
Desktop version
https://www.olesentuition.co.uk/German Lessons in London and Online with Expert Native TutorsLearn German with the top-rated German language school. ✓Qualified Native Tutors ✓1:1 German Lessons ✓Small German Classes ✓25+Years of Experience.
Mobile version
https://www.olesentuition.co.uk/German Lessons in London and Online with Expert Native TutorsLearn German with the top-rated German language school. ✓Qualified Native Tutors ✓1:1 German Lessons ✓Small German Classes ✓25+Years of Experience.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
German Lessons in London and Online with Expert Native Tutors
og:description
Learn German with the top-rated German language school. ✓Qualified Native Tutors ✓1:1 German Lessons ✓Small German Classes ✓25+Years of Experience.
og:image
https://static.wixstatic.com/media/4047b2_174c38539ad5492ab79b772bad4c9d52~mv2.jpg/v1/fill/w_2500,h_1666,al_c/4047b2_174c38539ad5492ab79b772bad4c9d52~mv2.jpg
og:image:width
2500
og:image:height
1666
og:url
https://www.olesentuition.co.uk
og:site_name
Olesen Tuition- German lessons in London and online
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
206german178explore120course95book91plans
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
german
explore
course
book
plans
Keywords Cloud Test
advancedavailablebeginnerbeginnersblogbookbritishbusinesschildrenclassesclientscontactcorporatecoursecoursesdatedeutschlehrereasterelementaryexamexamsexcellentexperienceexperiencedexplorefastfavouritefebruaryfluencygcsegermangreekhalfhampsteadhavehomehybridigcseintensiveintermediateislandsjanuaryjenskidsknowledgelanguagelearnlearninglessonlessonslevellevelslinkslondonmethodsminsminutemondaysnativenearofferofficeolesenonlineonsitepagepersonplanspoundspreparationpriorprivateprofessionalratedresourcesreviewsrevisionschoolsearchspotsspringstartstartsstellestudentssundaystaughtteachingteenagerstermtestimonialsthursdaystuesdaystuitiontutortutorsupperwednesdaysyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Learn German in London with Olesen Tuition
Book Your German Lessons Now
H2 tags
German Lessons in London and Online with Expert Native Tutors
German Classes in London and Online with Only 4-7 Students
1:1 German Lesson (60 mins)
1:1 German Lesson (90 mins)
1:1 German Lesson (120 mins)
2:1 Lesson (60 mins)
1:1 In-Person German lesson (60 mins)
1:1 German Exam Preparation (60 mins)
1:1 German Exam Preparation (90 mins)
1:1 German Exam Preparation (120 mins)
Online 1:1 German Lesson (60 mins)
Online 1:1 German Lesson (90 mins)
Online 1:1 German Lesson (120 mins)
1:1 German Lesson for Children (45 mins)
1:1 German Lesson for Children (60 mins)
1:1 German Lesson for Children (90 mins)
1:1 German Lesson for Children (2h)
A1.1 German Course Saturdays 2.30-4pm
A1.1 German Course Sundays 11.30-1pm
A1.1 German Course Mondays 8-9.30am
A1.1 German Course Mondays 7.30-9pm
A1.1 German Course Tuesdays 8-9.30am
A1.1 German Course Tuesdays 8-9.30pm
A1.1 German Course Thursdays 6-7.30pm
A1.1 German Course Thursdays 7.30-9pm
A1.2 German Course Saturday 2.30-4pm
A1.2 German Course Mondays 6-7.30pm
A1.2 German Course Tuesdays 8-9.30am
A1.2 German Course Tuesdays 8-9.30pm
A1.2 German Course Wednesdays 8-9.30am
A1.2 German Course Thursdays 6-7.30pm
A1.2 German Course Thursdays 7.30-9pm
A2.1 German Course Sundays 7-8.30pm
A2.1 German Course Mondays 8-9.30am
A2.1 German Course Mondays 6-7.30pm
A2.1 German Course Tuesdays 11.30-1pm
A2.1 German Course Tuesdays 8-9.30pm
A2.1 German Course Wednesdays 7-8.30pm
A2.1 German Course Thursdays 8-9.30am
A2.1 German Course Thursdays 7.30-9pm
A2.2 German Course Sundays 7-8.30pm
A2.2 German Course Tuesdays 11.30-1pm
A2.2 German Course Tuesdays 7-8.30pm
B1.1 German Course Mondays 6-7.30pm
B1.1 German Course Tuesdays 8-9.30am
B1.1 German Course Tuesdays 7-8.30pm
B1.1 German Course Thursdays 6-7.30pm
B1.1 German Course Thursdays 7.30-9pm
B1.2 German Course Sundays 1-2.30pm
B2.1 German Course Sundays 1-2.30pm
B2.1 German Course Mondays 4.30-6pm
B2.1 German Course Tuesdays 8-9.30am
B2.1 German Course Tuesdays 6-7.30pm
B2.1 German Course Thursdays 6-7.30pm
B2.1 German Course Thursdays 7.30-9pm
B2.2 German Course Wednesdays 7.30-9pm
C1.1 German Course Mondays 6-7.30pm
C1.1 German Course Wednesdays 7.30-9pm
C1.1 German Course Thursdays 6-7.30pm
C1.2 German Course Tuesdays 7.30-9pm
C2 German Course Sundays 5.30-7pm
C2 German Course Thursdays 7.30-9pm
GCSE German Course Sundays 11.30-1pm
GCSE German course Mondays 6-7.30pm
GCSE German course Thursdays 6.30-8pm
Intensive GCSE German Revision Course
A-Level German Course Sundays 10-11.30am
A-Level German Course Thursdays 6-7.30pm
Intensive A-level German Revision Course
IB German Course Thursdays 6-7.30pm
IB German Course Thursdays 1-2.30pm
1:1 Business German Lesson (60 mins)
1:1 Business German Lesson (90 mins)
1:1 Business German Lesson (120 mins)
Onsite Business German Lesson (60 mins)
Onsite Business German Lesson (90 mins)
Onsite Business German Lesson (120 mins)
A1.1 Intensive German Course 7.30-9pm
A2.1 Intensive German Course 7.30-9pm
A1.1 Course SAT 2.30-4pm (6-10 YO)
A1.1 Course WED 5-6.30pm (8-12 YO)
A1.1 Course THUR 6.30-8pm (12-16 YO)
A1.2 Course SAT 1-2.30pm (12-16 YO)
A1.2 Course THUR 5-6.30pm (8-12 YO)
A2.1 Course SAT 2.30-4pm
A2.1 Course WED 6.30-8pm (12-16 YO)
B1.1 Course WED 6.30-8pm (12-16 YO)
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test29% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 86
Failed: 4
Warnings: 1
Passed: 20
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 4,263 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 2402.49 Kb to 285.39 Kb (88% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.4 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
61.5 %
1.33 Mb
image
18.5 %
409.13 Kb
html
11.6 %
256.78 Kb
other
5.3 %
117.56 Kb
font
3.0 %
66.16 Kb
css
0.1 %
2.30 Kb
TOTAL
100%
2.16 Mb
Requests by content type
Content type
Percent
Requests
javascript
51.7 %
107
image
35.7 %
74
other
10.1 %
21
font
1.4 %
3
html
0.5 %
1
css
0.5 %
1
TOTAL
100%
207
Content size by domain
Domain
Percent
Size
static.parastorage.com
41.8 %
924.25 Kb
olesentuition.co.uk
20.2 %
447.76 Kb
static.wixstatic.com
18.5 %
409.00 Kb
googletagmanager.com
10.0 %
221.68 Kb
siteassets.parastorage.com
3.8 %
84.54 Kb
connect.facebook.net
3.4 %
74.86 Kb
google-analytics.com
1.0 %
22.51 Kb
browser.sentry-cdn.com
0.9 %
20.39 Kb
googleads.g.doubleclick.net
0.2 %
4.59 Kb
frog.wix.com
0.1 %
2.02 Kb
Other
0.1 %
1.29 Kb
TOTAL
100%
2.16 Mb
Requests by domain
Domain
Percent
Requests
static.parastorage.com
49.8 %
103
static.wixstatic.com
34.8 %
72
frog.wix.com
3.9 %
8
olesentuition.co.uk
2.4 %
5
siteassets.parastorage.com
1.9 %
4
google-analytics.com
1.4 %
3
googletagmanager.com
1.0 %
2
connect.facebook.net
1.0 %
2
googleads.g.doubleclick.net
1.0 %
2
google.com
1.0 %
2
Other
1.9 %
4
TOTAL
100%
207
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.013 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.013 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.813 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.813 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.47 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.47 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://static.wixstatic.com/media/4047b2_9fe683ce..." alt="Jens Olesen, the founder of Olesen Tuition, teachi..." style="width:978px;height:688px;object-fit:cover" width="978" height="688" srcset="https://static.wixstatic.com/media/4047b2_9fe683ce..." fetchpriority="high">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0207. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0207

0.1

0.25

Server and security
Score: 97
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.olesentuition.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
olesentuition.co.uk
Subject Alternative Names (SANs)
olesentuition.co.uk, www.olesentuition.co.uk
Not valid before
Tue, January 28o 2025, 1:30:21 am (z)
Not valid after
Mon, April 28o 2025, 1:30:20 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R10
Intermediate certificate
Common name
R10
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=86400
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.olesentuition.co.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.olesentuition.co.uk" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved