seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.my-hammer.de
Your general SEO Checkup Score
Archived
89/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 89 out of 100, which is higher than the average score of 75. Our analysis has identified 7 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
7 Failed
2 Warnings
63 Passed
Issues to fix
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 76
Failed: 4
Warnings: 1
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 61 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: MyHammer – der kostenlose Marktplatz für Handwerks-Leistungen
Length: 61 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Haben Sie einen Auftrag in oder bei Ihrem Haus? Überlassen Sie ihn den Profis. Veröffentlichen Sie Ihren Auftrag kostenlos auf MyHammer und erhalten Sie Angebote von Handwerkern in Ihrer Nähe.
Length: 192 characters
Google Search Results Preview Test
Desktop version
https://www.my-hammer.de/MyHammer – der kostenlose Marktplatz für Handwerks-LeistungenHaben Sie einen Auftrag in oder bei Ihrem Haus? Überlassen Sie ihn den Profis. Veröffentlichen Sie Ihren Auftrag kostenlos auf MyHammer und erhalten Sie Angebote von Handwerkern in Ihrer Nähe.
Mobile version
https://www.my-hammer.de/MyHammer – der kostenlose Marktplatz für Handwerks-LeistungenHaben Sie einen Auftrag in oder bei Ihrem Haus? Überlassen Sie ihn den Profis. Veröffentlichen Sie Ihren Auftrag kostenlos auf MyHammer und erhalten Sie Angebote von Handwerkern in Ihrer Nähe.
Social Media Meta Tags Test94% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
33verwendet26http24handwerker22website22wird
Keywords Usage Test44% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
verwendet
http
handwerker
website
wird
Keywords Cloud Test
ablaufalleanalyticsanbieteranmeldenanstehendanzeigeanzeigenauftragaufträgebasierendbauenbenutzerbenutzersbenötigenberichtebesucherbesuchersbetreibercookiecookiesdatendeutschlanddienstdienstedienstleistungdiesedieserdurchschnittlicheneindeutigeeineeinemeingebettetenerstellenerstelltfensterfindengartengebengooglehabenhammerhandwerkerhtmlhttpihnenihreihrerinformationeninternesjahrkategoriekostenkönnenleistungenmedienmehrerenmicrosoftmyhammernetworkingnutzungoderpartnerpersistentpinterestpixelpreisinformationenpräferenzenpräsentierenregistriertrelevanterenovierenrichtigensammeltsanitärservicessessionsichsindsocialstatistischetiktoktürenunsererverfolgenverhaltenverwendetvorstellungwebseitewebseitenwebsitewebsiteswerbungwerdenwirdzusammengestelltzweckähnlicheüberübersicht
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test57% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
MyHammer
Finden Sie einen zuverlässigen Handwerker für alle Aufträge in Ihrem Zuhause.
H2 tags
So finden Sie den richtigen Handwerker
Bereit für den Sommer?
Immer gefragt
Finden Sie Handwerker für jeden Auftrag
Erhalten Sie die gewünschten Ergebnisse
Sie sind Handwerker?
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test80% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test76% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test31% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test68% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test92% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test73% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test58% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test32% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test98% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test64% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Pinterest Twitter 
Speed optimizations
Score: 93
Failed: 2
Warnings: 0
Passed: 23
HTML Page Size Test17% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,159 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 215.28 Kb to 40.57 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.13 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test78% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
77.9 %
710.69 Kb
other
8.8 %
80.55 Kb
font
5.5 %
50.55 Kb
image
4.6 %
42.30 Kb
html
3.1 %
28.49 Kb
css
0.0 %
0 B
TOTAL
100%
912.58 Kb
Requests by content type
Content type
Percent
Requests
javascript
52.8 %
47
image
27.0 %
24
other
14.6 %
13
html
3.4 %
3
font
2.2 %
2
css
0.0 %
0
TOTAL
100%
89
Content size by domain
Domain
Percent
Size
my-hammer.de
72.5 %
661.90 Kb
googletagmanager.com
13.0 %
118.99 Kb
consent.cookiebot.com
10.5 %
95.66 Kb
widget.trustpilot.com
3.0 %
27.70 Kb
static.cloudflareinsights.com
0.8 %
6.90 Kb
consentcdn.cookiebot.com
0.1 %
811 B
api.my-hammer.de
0.1 %
651 B
TOTAL
100%
912.58 Kb
Requests by domain
Domain
Percent
Requests
my-hammer.de
86.5 %
77
widget.trustpilot.com
5.6 %
5
api.my-hammer.de
2.2 %
2
consent.cookiebot.com
2.2 %
2
static.cloudflareinsights.com
1.1 %
1
googletagmanager.com
1.1 %
1
consentcdn.cookiebot.com
1.1 %
1
TOTAL
100%
89
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test26% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test69% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test98% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test99% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test14% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.517 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.517 s

0.8 s

1.8 s

First Contentful Paint Test97% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.840 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.84 s

1.8 s

3 s

Largest Contentful Paint Test92% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.13 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.13 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="/home/1440x636.jpg" srcset="/home/480x586.jpg 480w, /home/768x586.jpg 768w, /h..." alt="" fetchpriority="high">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test96% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.my-hammer.de" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
my-hammer.de
Subject Alternative Names (SANs)
*.my-hammer.de, *.production.my-hammer.de, *.r.my-hammer.de, *.sandbox.my-hammer.de, *.staging.my-hammer.de, my-hammer.de
Not valid before
Mon, August 28o 2023, 5:52:20 pm (z)
Not valid after
Sun, November 26o 2023, 5:52:19 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
E1
Intermediate certificate
Common name
E1
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Intermediate certificate
Common name
ISRG Root X2
Organization
Internet Security Research Group
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test95% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test85% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=15724800; includesubdomains
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test99% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test90% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, viewport-fit=cover" />
Media Query Responsive Test100% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test78% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test100% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test96% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test97% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx a:fiqas.reputy.nl a:mx-03.myhammer.net a:mailrelay01.myhammer.net ip4:31.209.124.96/28 ip4:52.31.69.155/32 ip4:34.240.92.179/32 include:trustpilotservice.com ~all
Ads.txt Validation Test66% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved