www.my-hammer.de SEO Report | SEO Site Checkup

Pricing Free Tools Articles

Report generated 2 years ago

https://www.my-hammer.de

Your general SEO Checkup Score

Archived

89/100

SEO Score

Average SEO score of top 100 sites: 75%

This website received an SEO score of 89 out of 100, which is higher than the average score of 75. Our analysis has identified 7 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.

7 Failed

2 Warnings

65 Passed

Issues to fix

HIGH

To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.

HIGH

Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.

HIGH

Consider reducing the HTML size to improve loading times and retain visitors.

MEDIUM

Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.

LOW

Using more than 20 HTTP requests on a webpage can negatively impact the loading time.

LOW

Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.

Common SEO issues

Score: 76

Failed: 4

Warnings: 1

Passed: 21

Meta Title Test100% of top 100 sites passed

This webpage is using a title tag with a length of 61 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.

Text: MyHammer – der kostenlose Marktplatz für Handwerks-Leistungen

Length: 61 characters

Meta Description Test97% of top 100 sites passed

This webpage is using a meta description tag.

Text: Haben Sie einen Auftrag in oder bei Ihrem Haus? Überlassen Sie ihn den Profis. Veröffentlichen Sie Ihren Auftrag kostenlos auf MyHammer und erhalten Sie Angebote von Handwerkern in Ihrer Nähe.

Length: 192 characters

Google Search Results Preview Test

Desktop version

https://www.my-hammer.de/MyHammer – der kostenlose Marktplatz für Handwerks-LeistungenHaben Sie einen Auftrag in oder bei Ihrem Haus? Überlassen Sie ihn den Profis. Veröffentlichen Sie Ihren Auftrag kostenlos auf MyHammer und erhalten Sie Angebote von Handwerkern in Ihrer Nähe.

Mobile version

Most Common Keywords Test

There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.

33verwendet26http24handwerker22website22wird

Keywords Usage Test44% of top 100 sites passed

The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.

Keyword

Title tag

Meta description

Headings

verwendet

http

handwerker

website

wird

Keywords Cloud Test

ablaufalleanalyticsanbieteranmeldenanstehendanzeigeanzeigenauftragaufträgebasierendbauenbenutzerbenutzersbenötigenberichtebesucherbesuchersbetreibercookiecookiesdatendeutschlanddienstdienstedienstleistungdiesedieserdurchschnittlicheneindeutigeeineeinemeingebettetenerstellenerstelltfensterfindengartengebengooglehabenhammerhandwerkerhtmlhttpihnenihreihrerinformationeninternesjahrkategoriekostenkönnenleistungenmedienmehrerenmicrosoftmyhammernetworkingnutzungoderpartnerpersistentpinterestpixelpreisinformationenpräferenzenpräsentierenregistriertrelevanterenovierenrichtigensammeltsanitärservicessessionsichsindsocialstatistischetiktoktürenunsererverfolgenverhaltenverwendetvorstellungwebseitewebseitenwebsitewebsiteswerbungwerdenwirdzusammengestelltzweckähnlicheüberübersicht

Competitor Domains Test

Heading Tags Test57% of top 100 sites passed

This webpage contains headings tags.

MyHammer

Finden Sie einen zuverlässigen Handwerker für alle Aufträge in Ihrem Zuhause.

So finden Sie den richtigen Handwerker

Bereit für den Sommer?

Immer gefragt

Finden Sie Handwerker für jeden Auftrag

Erhalten Sie die gewünschten Ergebnisse

Sie sind Handwerker?

Robots.txt Test99% of top 100 sites passed

This website is using a robots.txt file.

https://www.my-hammer.de/robots.txt

Sitemap Test80% of top 100 sites passed

This website has a sitemap file.

https://www.my-hammer.de/sitemap.xml

Broken Links Test

SEO Friendly URL Test29% of top 100 sites passed

All links from this webpage are SEO friendly.

Image Alt Test76% of top 100 sites passed

This webpage is using "img" tags with empty or missing "alt" attribute!

Responsive Image Test31% of top 100 sites passed

All images in this webpage are properly sized for different users' viewports.

Image Aspect Ratio Test68% of top 100 sites passed

All image display dimensions match the natural aspect ratio.

Inline CSS Test10% of top 100 sites passed

This webpage is using inline CSS styles!

Deprecated HTML Tags Test92% of top 100 sites passed

This webpage does not use HTML deprecated tags.

Google Analytics Test73% of top 100 sites passed

This webpage is using Google Analytics.

Favicon Test100% of top 100 sites passed

This website appears to have a favicon.

Backlinks Test

JS Error Test58% of top 100 sites passed

There are no severe JavaScript errors on this webpage.

Console Errors Test32% of top 100 sites passed

This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.

Charset Declaration Test98% of top 100 sites passed

This webpage has a character encoding declaration.

Content-Type: text/html; charset=utf-8

Speed optimizations

Score: 93

Failed: 2

Warnings: 0

Passed: 23

HTML Page Size Test17% of top 100 sites passed

The size of this webpage's HTML is 40.57 Kb, and is greater than the average size of 33 Kb! This can lead to slower loading times, lost visitors, and decreased revenue. Good steps to reduce HTML size include: using HTML compression, CSS layouts, external style sheets, and moving javascript to external files.

DOM Size Test56% of top 100 sites passed

The Document Object Model (DOM) of this webpage has 1,159 nodes which is less than the recommended value of 1,500 nodes.

HTML Compression/GZIP Test97% of top 100 sites passed

This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 215.28 Kb to 40.57 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.

Site Loading Speed Test68% of top 100 sites passed

The loading time of this webpage (measured from N. Virginia, US) is around 1.13 seconds and this is under the average loading speed which is 5 seconds.

JS Execution Time Test78% of top 100 sites passed

The JavaScript code used by this webpage is executed in less than 2 seconds.

Page Objects Test

This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!

Content size by content type

Content type

Percent

Size

javascript

77.9 %

710.69 Kb

other

8.8 %

80.55 Kb

font

5.5 %

50.55 Kb

image

4.6 %

42.30 Kb

html

3.1 %

28.49 Kb

css

0.0 %

0 B

Requests by content type

Content type

Percent

Requests

javascript

52.8 %

image

27.0 %

other

14.6 %

html

3.4 %

font

2.2 %

css

0.0 %

Content size by domain

Domain

Percent

Size

my-hammer.de

72.5 %

661.90 Kb

googletagmanager.com

13.0 %

118.99 Kb

consent.cookiebot.com

10.5 %

95.66 Kb

widget.trustpilot.com

3.0 %

27.70 Kb

static.cloudflareinsights.com

0.8 %

6.90 Kb

consentcdn.cookiebot.com

0.1 %

811 B

api.my-hammer.de

0.1 %

651 B

Requests by domain

Domain

Percent

Requests

my-hammer.de

86.5 %

widget.trustpilot.com

5.6 %

api.my-hammer.de

2.2 %

consent.cookiebot.com

2.2 %

static.cloudflareinsights.com

1.1 %

googletagmanager.com

1.1 %

consentcdn.cookiebot.com

1.1 %

Page Cache Test (Server Side Caching)100% of top 100 sites passed

This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.

Flash Test100% of top 100 sites passed

This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.

CDN Usage Test96% of top 100 sites passed

This webpage is serving all images, javascript and css resources from CDNs.

Modern Image Format Test26% of top 100 sites passed

This webpage is using images in a modern format.

Image Metadata Test69% of top 100 sites passed

This webpage is not using images with large metadata.

Image Caching Test98% of top 100 sites passed

This website is using cache headers for images and the browsers will display these images from the cache.

JavaScript Caching Test96% of top 100 sites passed

This webpage is using cache headers for all JavaScript resources.

CSS Caching Test98% of top 100 sites passed

This webpage is not using uncached CSS resources from same domain!

JavaScript Minification Test99% of top 100 sites passed

All JavaScript files used by this webpage are minified.

CSS Minification Test100% of top 100 sites passed

This webpage is not using CSS resources from the same domain.

Render Blocking Resources Test14% of top 100 sites passed

This webpage is not using render-blocking resources.

Nested Tables Test99% of top 100 sites passed

This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.

Frameset Test100% of top 100 sites passed

This webpage does not use frames.

Doctype Test100% of top 100 sites passed

This webpage has a doctype declaration.

<!DOCTYPE html>

URL Redirects Test97% of top 100 sites passed

This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).

Time To First Byte Test98% of top 100 sites passed

The Time To First Byte value of this webpage is 0.517 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.517 s

0.8 s

1.8 s

First Contentful Paint Test97% of top 100 sites passed

The First Contentful Paint value of this webpage is 0.840 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.84 s

1.8 s

3 s

Largest Contentful Paint Test92% of top 100 sites passed

The Largest Contentful Paint duration of this webpage is 1.13 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.13 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:

<img src="/home/1440x636.jpg" srcset="/home/480x586.jpg 480w, /home/768x586.jpg 768w, /h..." alt="" fetchpriority="high">

Cumulative Layout Shift Test94% of top 100 sites passed

The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

Server and security

Score: 100

Failed: 0

Warnings: 0

Passed: 10

URL Canonicalization Test96% of top 100 sites passed

https://www.my-hammer.de/ and https://my-hammer.de/ resolve to the same URL.

SSL Checker and HTTPS Test100% of top 100 sites passed

This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.my-hammer.de" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:

Server certificate

Common name

my-hammer.de

Subject Alternative Names (SANs)

*.my-hammer.de, *.production.my-hammer.de, *.r.my-hammer.de, *.sandbox.my-hammer.de, *.staging.my-hammer.de, my-hammer.de

Not valid before

Mon, August 28o 2023, 5:52:20 pm (z)

Not valid after

Sun, November 26o 2023, 5:52:19 pm (z)

Signature algorithm

ecdsaWithSha384

Issuer

Intermediate certificate

Common name

Organization

Let's Encrypt

Location

Not valid before

Fri, September 4o 2020, 12:00:00 am (z)

Not valid after

Mon, September 15o 2025, 4:00:00 pm (z)

Signature algorithm

ecdsaWithSha384

Issuer

ISRG Root X2

Intermediate certificate

Common name

ISRG Root X2

Organization

Internet Security Research Group

Location

Not valid before

Fri, September 4o 2020, 12:00:00 am (z)

Not valid after

Mon, September 15o 2025, 4:00:00 pm (z)

Signature algorithm

sha256WithRsaEncryption

Issuer

ISRG Root X1

Root certificate

Common name

ISRG Root X1

Organization

Internet Security Research Group

Location

Not valid before

Thu, June 4o 2015, 11:04:38 am (z)

Not valid after

Mon, June 4o 2035, 11:04:38 am (z)

Signature algorithm

sha256WithRsaEncryption

Issuer

ISRG Root X1

Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed

This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.

HTTP2 Test95% of top 100 sites passed

This webpage is using the HTTP/2 protocol.

HSTS Test85% of top 100 sites passed

This webpage is using the Strict-Transport-Security header.

strict-transport-security: max-age=15724800; includesubdomains

Safe Browsing Test100% of top 100 sites passed

This website is not currently listed as suspicious (no malware or phishing activity found).

Server Signature Test98% of top 100 sites passed

The server signature is off for this webpage.

Directory Browsing Test100% of top 100 sites passed

Directory browsing is disabled for this website.

Plaintext Emails Test99% of top 100 sites passed

This webpage does not include email addresses in plaintext.

Unsafe Cross-Origin Links Test48% of top 100 sites passed

This webpage is not using target="_blank" links without rel="noopener" or rel="noreferrer" attribute.

Mobile usability

Score: 100

Failed: 0

Warnings: 0

Passed: 3

Meta Viewport Test90% of top 100 sites passed

This webpage is using a viewport meta tag.

<meta name="viewport" content="width=device-width, initial-scale=1, viewport-fit=cover" />

Media Query Responsive Test100% of top 100 sites passed

This webpage is using CSS media queries, which is the base for responsive design functionalities.

Mobile Snapshot Test

Advanced SEO

Score: 98

Failed: 1

Warnings: 1

Passed: 8

Structured Data Test66% of top 100 sites passed

This webpage is using structured data.

Custom 404 Error Page Test78% of top 100 sites passed

This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.

Noindex Tag Test100% of top 100 sites passed

This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.

Canonical Tag Test96% of top 100 sites passed

This webpage does not use the canonical link tag.

Nofollow Tag Test

This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.

Disallow Directive Test

Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).

Meta Refresh Test96% of top 100 sites passed

This webpage is not using a meta refresh tag.

SPF Records Test97% of top 100 sites passed

This DNS server is using an SPF record.

v=spf1 mx a:fiqas.reputy.nl a:mx-03.myhammer.net a:mailrelay01.myhammer.net ip4:31.209.124.96/28 ip4:52.31.69.155/32 ip4:34.240.92.179/32 include:trustpilotservice.com ~all

Ads.txt Validation Test66% of top 100 sites passed

This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

Spell Check Test

Report generated 2 years ago

https://www.my-hammer.de

Your general SEO Checkup Score

Archived

89/100

SEO Score

Average SEO score of top 100 sites: 75%

7 Failed

2 Warnings

65 Passed

Issues to fix

HIGH

To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.

HIGH

Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.

HIGH

Consider reducing the HTML size to improve loading times and retain visitors.

MEDIUM

Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.

LOW

Using more than 20 HTTP requests on a webpage can negatively impact the loading time.

LOW

Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.

Website SEO, Monitoring & Automation Made Easy.

Product

Pricing
Free Tools
Articles
Login
Free 7-Day Trial

Company

Legal

Find the keywords where this URL is listed in the top 20 results of Google's organic listings.

Understand your competitors' SEO and backlink profile

Looking for a Sitemap Generator Tool?

Check your webpage for broken links!

Get a full and detailed list of your backlinks!

Accurate loading speed and website loading speed monitor

Check your webpage for misspellings!