seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://www.mobdiun.org
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 111 out of 100, which is higher than the average score of 75. Our analysis has identified 2 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
2 Failed
0 Warnings
9 Passed
Common SEO issues
Score: 74
Failed: 1
Warnings: 0
Passed: 7
Google Search Results Preview
Desktop version
http://mobdiun.org/Mobdiun - Creative Youth | Mobdiun - Creative YouthNon-profit for youth social inclusion and social transformation using arts, culture, sports and technology in marginalized areas in Tunisia.
Mobile version
http://mobdiun.org/Mobdiun - Creative Youth | Mobdiun - Creative YouthNon-profit for youth social inclusion and social transformation using arts, culture, sports and technology in marginalized areas in Tunisia.
Keywords Cloud
abdennebiadamiadvisorafterschoolaimsanalysisareasartisticartsboutaiebbringbuildersbusinesschangecommunicationcommunitiescontactcoordinatorcreativecreativityculturedemocracyeducationempowerempoweringfaresfeaturedfollowfoundingfreegeneralhamdihomehumanitiesinclusioninspireinspiringjessicajoinkevinkhalifakhouloudkhÉlifaknowleadinglivingmachtamarginalizedmarketmeetmehdimembersmghirbimissionmobdiunnavigationnonprofitomaromezzinepeacefulpeoplepimentapositivepoweredpresidentprojectpromotesprovideprovidingqualityregionsseaidisecretarysimpleshiftskillssocialspecialistsportsstimulatestrategistsurveyteamtechnologythemethinkingtodaytoggletoolstransformationtreasurertunisiatunisianunitevietwayswebmasterwordpressyoungyoussefyouth
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
Image Alt Test
  • Your webpage has 15 'img' tags and 10 of them are missing the required 'alt' attribute.
See full list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved