seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.mecitefendi.com.tr
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 23 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
23 Failed
4 Warnings
45 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
A proper character encoding declaration ensures that all characters, including non-ASCII characters, are displayed correctly in the browser, improving the readability and usability of the webpage.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 47
Failed: 9
Warnings: 1
Passed: 12
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 65 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Mecitefendi Resmi Satış Sayfası | Bitkisel Doğal Kozmetik Ürünler
Length: 65 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Mecitefendi bitkisel & doğal kozmetik ürünler, sizi doğallıkla buluşturur. Kredi kartına taksit imkanı ve diğer ödeme seçenekleri ile keyifli alışverişler dileriz.
Length: 163 characters
Google Search Results Preview Test
Desktop version
https://www.mecitefendi.com.tr/Mecitefendi Resmi Satış Sayfası | Bitkisel Doğal Kozmetik ÜrünlerMecitefendi bitkisel & doğal kozmetik ürünler, sizi doğallıkla buluşturur. Kredi kartına taksit imkanı ve diğer ödeme seçenekleri ile keyifli alışverişler dileriz.
Mobile version
https://www.mecitefendi.com.tr/Mecitefendi Resmi Satış Sayfası | Bitkisel Doğal Kozmetik ÜrünlerMecitefendi bitkisel & doğal kozmetik ürünler, sizi doğallıkla buluşturur. Kredi kartına taksit imkanı ve diğer ödeme seçenekleri ile keyifli alışverişler dileriz.
Social Media Meta Tags Test94% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
32ürünleri23yağlar22ürünler17doğal16bitkisel
Keywords Usage Test44% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
ürünleri
yağlar
ürünler
doğal
bitkisel
Keywords Cloud Test
adresinizanasayfaaromalararomatiaromatikayakaynisefaağaciağizağızbakimbakımbalmibitkiselbizebodybutterciltdoğaldudakemailesansesansiesanslargidagirişgüneşgürkangıdahacihattihesabımisirganjellerikampanyalikapsülkargomkatalogkolonyalarkozmetikozmetikkremikremlerkudretkurumsallitrelikmacunlarmasajmecimecitefendimeckoznarinceleneredeorganiorganikparipaçulirkelersabisabitsabunsabunlarsandalsarimsaksatilansayfaselüliselülitsepetesepetiseriserisisetisirkelersorularinizsoslarsularsözleşmesitakvitakviyeleritefenditreliulaşınuçucuyağiyağlaryeleriyeniçaylarçerençörekotuözelöğütülmüşürünürünlerürünlerişampuanşampuanlarşifreniz
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test57% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test80% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test76% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test31% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test68% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test92% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
4center
Google Analytics Test73% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test58% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test32% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test98% of top 100 sites passed
  • This webpage has a meta charset tag but is not fully contained in the first 1024 bytes of the HTML document! The element containing the character encoding declaration must be serialized completely within the first 1024 bytes of the document, otherwise it can significantly affect load performance.
Speed optimizations
Score: 55
Failed: 8
Warnings: 2
Passed: 10
HTML Page Size Test17% of top 100 sites passed
  • The size of this webpage's HTML is 22.44 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 955 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 121.87 Kb to 22.44 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 10.31 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test78% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
75.4 %
5.94 Mb
javascript
17.7 %
1.39 Mb
font
3.9 %
316.50 Kb
css
1.3 %
106.62 Kb
other
1.0 %
83.52 Kb
html
0.6 %
51.68 Kb
TOTAL
100%
7.88 Mb
Requests by content type
Content type
Percent
Requests
image
44.7 %
63
javascript
23.4 %
33
css
12.8 %
18
font
8.5 %
12
other
8.5 %
12
html
2.1 %
3
TOTAL
100%
141
Content size by domain
Domain
Percent
Size
mecitefendi.com.tr
77.1 %
6.07 Mb
youtube.com
12.5 %
1011.32 Kb
fonts.gstatic.com
3.0 %
240.85 Kb
connect.facebook.net
2.2 %
175.03 Kb
code.jquery.com
1.2 %
98.74 Kb
googletagmanager.com
1.0 %
84.62 Kb
maxcdn.bootstrapcdn.com
1.0 %
82.98 Kb
i.ytimg.com
0.7 %
57.54 Kb
jnn-pa.googleapis.com
0.4 %
31.07 Kb
google-analytics.com
0.3 %
20.83 Kb
Other
0.6 %
44.68 Kb
TOTAL
100%
7.88 Mb
Requests by domain
Domain
Percent
Requests
mecitefendi.com.tr
65.2 %
92
fonts.gstatic.com
7.8 %
11
youtube.com
5.0 %
7
connect.facebook.net
2.8 %
4
fonts.googleapis.com
2.1 %
3
code.jquery.com
2.1 %
3
facebook.com
2.1 %
3
maxcdn.bootstrapcdn.com
1.4 %
2
google-analytics.com
1.4 %
2
stats.g.doubleclick.net
1.4 %
2
Other
8.5 %
12
TOTAL
100%
141
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test26% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test69% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test98% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test99% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test14% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 1.421 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.421 s

0.8 s

1.8 s

First Contentful Paint Test97% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.560 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.56 s

1.8 s

3 s

Largest Contentful Paint Test92% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 4.24 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4.24 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="images/slider/sandalagaci_bannerjpg-385.jpg" class="w100">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0243. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0243

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <img src="images/slider/sandalagaci_bannerjpg-385.jpg" class="w100">
Score: 0.0212
Server and security
Score: 68
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test96% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.mecitefendi.com.tr" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
mecitefendi.com.tr
Subject Alternative Names (SANs)
*.mecitefendi.com.tr, mecitefendi.com.tr
Not valid before
Mon, August 21o 2023, 5:36:20 am (z)
Not valid after
Sun, November 19o 2023, 5:36:19 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test95% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test85% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test99% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test90% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, user-scalable=no" />
Media Query Responsive Test100% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test78% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test100% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test96% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test97% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx a include:_spf.mecitefendi.com.tr -all
Ads.txt Validation Test66% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved