seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://www.mcservai.lt
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 109 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
0 Warnings
30 Passed
Common SEO issues
Score: 61
Failed: 3
Warnings: 0
Passed: 9
Google Search Results Preview Test
Desktop version
http://www.mcservai.lt/Minecraft serveriai, mc servai, mc serveriu sąrašasPopuliariausi Minecraft serveriai Lietuvoje. Žaidimo Minecraft serverių topas. Užsuk ir nemokamai įdėk savo minecraft serverį bei nesunkiai rask tau patinkantį mc servą
Mobile version
http://www.mcservai.lt/Minecraft serveriai, mc servai, mc serveriu sąrašasPopuliariausi Minecraft serveriai Lietuvoje. Žaidimo Minecraft serverių topas. Užsuk ir nemokamai įdėk savo minecraft serverį bei nesunkiai rask tau patinkantį mc servą
Keywords Cloud Test
[..][pvp]mclive.lt[pvpfaction]bestcavegamescraftforaallcreativecubas.ax.ltcubas.tt.ltdirbaender.ltendercraft.ltenjoyit.ltexiledcraftexiledcraft.ro.ltfactionsfreegamein.ltgfreakglobalcraft.tkgreitaiimine.ltisjungtasivrealmjustmc.ltkalejmaskalėjimaskuriamalietuvojemagmamc..eumc.bestmc..ltmc.blaze.ltmc.chetos.ltmc.craft.lvmc.crafting.lvmc.eclat.lvmc.fagerho.ltmc.fall.lvmc.gamein.ltmc.gamepic.mlmc.gfreak.ltmc.godplay.ltmc.goldcraft.lvmc.justmc.ltmc.kaimux.ltmc.koridorius.ltmc.kubai.ltmc.life.ltmc.mckingdom.ltmc.mcmidnight.ltmc.mprison.ltmc.multi.ltmc.naturexgaming.eumc.ngc.lvmc.ratio.lvmc.side.lvmc.skilas.ltmc.sunrise.lvmc.timenet.ltmc.unicraft.ltmc.unturned.ltmcblock.ax.ltmcblock[.][/]mceuras.craft.ggmckingdommclife.ltmcmidnightmcpalangemcpalange.srw.ltmcservai.ltminecraftminecraftiaminigamemmo/rpgmprison.ltnaturalneom.srw.ltneomc.ltnmncplay.mclife.ltpvp/survivalrebornreikserverserverioserverisserveriųskypespamerisspragile.ltsurvivaltestastopasunicraftunitedcraftuzsicraftinkversijavisiworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
http://www.mcservai.lt/sitemap.xml
Image Alt Test
  • Your webpage has 5 'img' tags and 4 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 5
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 71.97 Kb to 6.25 Kb (91 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 3.744 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 66
  • 16 HTML Pages
  • 6 CSS Files
  • 20 JS Files
  • 24 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 0
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your page does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 include:mx.ovh.com ~all
Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2026 • All rights reserved