seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.marmostucco.co.uk
Your general SEO Checkup Score
Archived
98/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 98 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
6 Warnings
54 Passed
Issues to fix
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 85
Failed: 2
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Polished Plaster London - Venetian Plaster Company UK
Length: 53 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Polished Plaster London, Venetian Plastering London, High end specialist contractors based in Surrey, experts in Marmorino, Concrete effects and Microcement.
Length: 157 characters
Google Search Results Preview Test
Desktop version
https://www.marmostucco.co.uk/Polished Plaster London - Venetian Plaster Company UKPolished Plaster London, Venetian Plastering London, High end specialist contractors based in Surrey, experts in Marmorino, Concrete effects and Microcement.
Mobile version
https://www.marmostucco.co.uk/Polished Plaster London - Venetian Plaster Company UKPolished Plaster London, Venetian Plastering London, High end specialist contractors based in Surrey, experts in Marmorino, Concrete effects and Microcement.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
business.business
og:url
https://www.marmostucco.co.uk/
og:title
Polished Plaster London - Venetian Plaster Company UK
og:description
Polished Plaster London, Venetian Plastering London, High end specialist contractors based in Surrey, experts in Marmorino, Concrete effects and Microcement.
og:image
https://www.marmostucco.co.uk/s/misc/logo.png?t=1727101238
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
158plaster143polished65venetian43london29finishes
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
plaster
polished
venetian
london
finishes
Keywords Cloud Test
applicationapplicationsappliedapplyarchitectsareaareasbasedbeautifulbespokecarriedchelseacleancoatcolourcommercialcompaniescompanyconcreteconsistentconstructioncontactcreatedatalayerdecorativedesigndesignersdifferentdistresseddoesdusteffecteffectsfeelfinefinishfinishesfunctiongooglegtaghavehonedinteriorinteriorslayerleaveleftlikelimelimestonelineslondonlookmarblemarmomarmorinomaterialnaturalofferpaintpatchesperlapittedplasterplasteringplasterspolishedportfolioprimerprivateproduceprojectprojectsrangereadremoverequestresidentialscriptslakedsmallsmoothspatulastuccosubstratesurfacesurreytechniquestimetrainedtroweluniqueurbanusingvenetianwallwallswindowworkworking
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Polished Plaster London - Venetian Plaster Company UK
H2 tags
Our Urban Concrete Venetian Plasters
The Classic Polished Plaster Finishes
A selection of our Past Projects
Request a Venetian Polished Plaster Sample
Does Venetian Plaster Crack?
We answer: How Do You Clean Venetian Plaster?
Is Polished Plaster Waterproof?
We answer: What does Polished Plaster look like?
Is Polished Plaster Expensive?
What Is The Difference Between Plaster And Venetian Plaster?
Marmo Surface Finishes - Contact Info
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
2u
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 82
Failed: 3
Warnings: 2
Passed: 15
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 16.93 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,074 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 96.49 Kb to 16.93 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.71 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
61.9 %
807.94 Kb
javascript
28.5 %
372.75 Kb
font
5.8 %
75.85 Kb
css
2.4 %
31.51 Kb
html
1.3 %
17.40 Kb
other
0.0 %
210 B
TOTAL
100%
1.28 Mb
Requests by content type
Content type
Percent
Requests
image
38.5 %
15
css
25.6 %
10
javascript
25.6 %
10
font
5.1 %
2
html
2.6 %
1
other
2.6 %
1
TOTAL
100%
39
Content size by domain
Domain
Percent
Size
marmostucco.co.uk
63.6 %
830.71 Kb
cdn.website-start.de
21.1 %
274.94 Kb
googletagmanager.com
13.6 %
177.76 Kb
google-analytics.com
1.6 %
21.00 Kb
101.sb.mywebsite-editor.com
0.1 %
1.25 Kb
TOTAL
100%
1.28 Mb
Requests by domain
Domain
Percent
Requests
cdn.website-start.de
43.6 %
17
marmostucco.co.uk
41.0 %
16
101.sb.mywebsite-editor.com
5.1 %
2
googletagmanager.com
5.1 %
2
google-analytics.com
5.1 %
2
TOTAL
100%
39
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.203 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.203 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.246 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.246 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.4 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.4 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="section-bg-element-inner " style=" background-image: url(https://www.marmostucco.co....">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0033. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0033

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0033
Server and security
Score: 73
Failed: 3
Warnings: 1
Passed: 3
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.marmostucco.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.marmostucco.co.uk
Subject Alternative Names (SANs)
*.marmostucco.co.uk, marmostucco.co.uk
Not valid before
Sun, November 26o 2023, 12:00:00 am (z)
Not valid after
Tue, December 10o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Encryption Everywhere DV TLS CA - G2
Intermediate certificate
Common name
Encryption Everywhere DV TLS CA - G2
Organization
DigiCert Inc
Location
US
Not valid before
Mon, November 27o 2017, 12:46:40 pm (z)
Not valid after
Sat, November 27o 2027, 12:46:40 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Root certificate
Common name
DigiCert Global Root G2
Organization
DigiCert Inc
Location
US
Not valid before
Thu, August 1o 2013, 12:00:00 pm (z)
Not valid after
Fri, January 15o 2038, 12:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol!
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 2 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1, minimal-ui" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf-eu.ionos.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved