seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.linkedin.com/authwall?trk=gf&trkInfo=AQFyJbC2Y56mMwAAAYGR8624Wc3DbdM2hWSqHc8ypwIGMaqLMkitDcvE6AvcGp7lv0cVO1vH5ItAsRrfD-5Wzysu8C6V2qc9HLGpvkZs4LzkKyG4Jom-eCblbzbHZAWHVsOgPOc=&original_referer=&sessionRedirect=https%3A%2F%2Fwww.linkedin.com%2Fin%2Fswapnil-jagtap-8976b0143
Your general SEO Checkup Score
Archived
76/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 76 out of 100, which is higher than the average score of 74. Our analysis has identified 15 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
15 Failed
0 Warnings
52 Passed
Common SEO issues
Score: 60
Failed: 8
Warnings: 0
Passed: 18
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Sign In | LinkedIn
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: 750 million+ members | Manage your professional identity. Build and engage with your professional network. Access knowledge, insights and opportunities.
Google Search Results Preview Test
Desktop version
https://www.linkedin.com/authwall?trk=gf&trkInfo=AQFyJbC2Y56mMwAAAYGR8624Wc3DbdM2hWSqHc8ypwIGMaqLMkitDcvE6AvcGp7lv0cVO1vH5ItAsRrfD-5Wzysu8C6V2qc9HLGpvkZs4LzkKyG4Jom-eCblbzbHZAWHVsOgPOc=&original_referer=&sessionRedirect=https%3A%2F%2Fwww.linkedin.com%2Fin%2Fswapnil-jagtap-8976b0143Sign In | LinkedIn750 million+ members | Manage your professional identity. Build and engage with your professional network. Access knowledge, insights and opportunities.
Mobile version
https://www.linkedin.com/authwall?trk=gf&trkInfo=AQFyJbC2Y56mMwAAAYGR8624Wc3DbdM2hWSqHc8ypwIGMaqLMkitDcvE6AvcGp7lv0cVO1vH5ItAsRrfD-5Wzysu8C6V2qc9HLGpvkZs4LzkKyG4Jom-eCblbzbHZAWHVsOgPOc=&original_referer=&sessionRedirect=https%3A%2F%2Fwww.linkedin.com%2Fin%2Fswapnil-jagtap-8976b0143Sign In | LinkedIn750 million+ members | Manage your professional identity. Build and engage with your professional network. Access knowledge, insights and opportunities.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Sign Up | LinkedIn
og:image
https://static-exp2.licdn.com/scds/common/u/images/logos/favicons/v1/favicon.ico
og:type
website
og:url
/authwall
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
6linkedin6policy5join4sign3password
Keywords Usage Test81% of top 100 sites passed
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
accessibilityagreeagreementarabicbahasabrandcharacterschineseclickingclosecommunitycontentcontrolscookiecopyrightczechdanishdanskdeutschdutchemailenglishespañolforgotfrançaisfrenchgermangoogleguestguidelineshindiindonesiaitalianitalianojapanesejoinkoreanlanguagelinkedinmainmalaymalaysianederlandsnorsknorwegiannumberpasswordphonephotopolicypolishpolskiportugueseportuguêsprivacyremoveromanianromânărussiansecuritysignsimplifiedskipspanishsvenskaswedishtagalogthaitraditionalturkishtürkçeuserverificationčeštinaрусскийالعربيةภาษาไทย正體中文简体中文
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Congratulations! Your webpage contains headings tags.
H1 tags
Join LinkedIn
H2 tags
Sign in
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • Your webpage doesn't use "img" tags.
Responsive Image Test38% of top 100 sites passed
  • All images in this page are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 89
Failed: 3
Warnings: 0
Passed: 17
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 12.77 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,530 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 69.32 Kb to 12.77 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 0.6 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
javascript
88.5 %
435.14 Kb
css
7.0 %
34.60 Kb
html
2.8 %
13.86 Kb
image
1.1 %
5.23 Kb
other
0.6 %
2.95 Kb
font
0.0 %
0 B
TOTAL
100%
491.78 Kb
Requests by content type
Content type
Percent
Requests
javascript
30.4 %
7
image
30.4 %
7
html
17.4 %
4
other
17.4 %
4
css
4.3 %
1
font
0.0 %
0
TOTAL
100%
23
Content size by domain
Domain
Percent
Size
static-exp2.licdn.com
89.2 %
438.68 Kb
gstatic.com
7.0 %
34.35 Kb
linkedin.com
3.1 %
15.38 Kb
accounts.google.com
0.7 %
3.38 Kb
TOTAL
100%
491.78 Kb
Requests by domain
Domain
Percent
Requests
static-exp2.licdn.com
56.5 %
13
linkedin.com
26.1 %
6
accounts.google.com
13.0 %
3
gstatic.com
4.3 %
1
TOTAL
100%
23
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 8
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.linkedin.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.linkedin.com
Organization
LinkedIn Corporation
Location
Sunnyvale, California, US
Subject Alternative Names (SANs)
www.linkedin.com, linkedin.com, rum5.perf.linkedin.com, exp4.www.linkedin.com, exp3.www.linkedin.com, exp2.www.linkedin.com, exp1.www.linkedin.com, rum2.perf.linkedin.com, rum4.perf.linkedin.com, rum6.perf.linkedin.com, rum17.perf.linkedin.com, rum8.perf.linkedin.com, rum9.perf.linkedin.com, afd.perf.linkedin.com, rum14.perf.linkedin.com, rum18.perf.linkedin.com, rum19.perf.linkedin.com, exp5.www.linkedin.com, realtime.www.linkedin.com, px.ads.linkedin.com, px4.ads.linkedin.com, dc.ads.linkedin.com, lnkd.in, px.jobs.linkedin.com, mid4.linkedin.com
Not valid before
Mon, March 28o 2022, 12:00:00 am (z)
Not valid after
Wed, September 28o 2022, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert SHA2 Secure Server CA
Intermediate certificate
Common name
DigiCert SHA2 Secure Server CA
Organization
DigiCert Inc
Location
US
Not valid before
Wed, September 23o 2020, 12:00:00 am (z)
Not valid after
Sun, September 22o 2030, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Root certificate
Common name
DigiCert Global Root CA
Organization
DigiCert Inc
Location
US
Not valid before
Fri, November 10o 2006, 12:00:00 am (z)
Not valid after
Mon, November 10o 2031, 12:00:00 am (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, minimum-scale=1.0, maximum-scale=1.0, user-scalable=no" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 27
Failed: 4
Warnings: 0
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage uses the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
See results list
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: /authwall should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="/authwall" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 ip4:199.101.162.0/25 ip4:108.174.3.0/24 ip4:108.174.6.0/24 ip4:108.174.0.0/24 ip6:2620:109:c00d:104::/64 ip6:2620:109:c006:104::/64 ip6:2620:109:c003:104::/64 ip6:2620:119:50c0:207::/64 ip4:199.101.161.130 mx mx:docusign.net ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved