seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.jindalgroupofindustries.com/index.html
Your general SEO Checkup Score
Archived
86/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 86 out of 100, which is higher than the average score of 75. Our analysis has identified 15 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
15 Failed
2 Warnings
31 Passed
Common SEO issues
Score: 54
Failed: 5
Warnings: 2
Passed: 10
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: JINDAL GROUP OF INDUSTRIES
Meta Description
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview
Desktop version
http://www.jindalgroupofindustries.com/index.htmlJINDAL GROUP OF INDUSTRIES
Mobile version
http://www.jindalgroupofindustries.com/index.htmlJINDAL GROUP OF INDUSTRIES
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
16jindal10group8tapes7industries6news
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
africaagileasiaauctoraugueautomobilebusinesscementchinaclientscoalcommodityconglomerateconguecontactcurabiturdileepdileep@adsinfoworld.comdistillerydiverseeastelectricalelectronicemailencompasseseuropeexceedingfabricfelisfmcgfoodfootprintframeworksfreegarmentglobalgroupguptahighhomeindiaindustrialindustriesinfo@jindalgroupofindustries.cominfrastructureitemsiterajindallacuslaminationlearnlevelleveragelightsmarketmiddlemillionmulti-facetednavigationnewsnibhnisloverviewspackagingpaperpharmaceuticalsphonephotophusphateplasticplasticspolymersportfoliopresenceprintingproductproductsprovidequickquotereadrevenuesricerobustrocksegmentservicesspecialtysteelsteelsstrongsynopsistapestoggletractorsullamcorperultriciesvariusvulputatewelcome
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Jindal Automobile
Jindal Pharmaceuticals
Jindal Steels
Jindal Infrastructure
Jindal Distillery
About Us
Happy Clients
Our News
H2 tags
WELCOME TO JINDAL GROUP OF INDUSTRIES
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 53
Failed: 4
Warnings: 0
Passed: 4
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 6.51 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 40.27 Kb to 6.51 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.64 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 35
  • 1 HTML Pages
  • 7 CSS Files
  • 12 JS Files
  • 15 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 3
Warnings: 0
Passed: 0
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 4 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 a mx ptr include:secureserver.net ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved