seo site checkup logo
PricingFree ToolsArticles
Report generated 5 days ago
http://www.hurenvoorevents.be
Your general SEO Checkup Score
Archived
72/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 72 out of 100, which is below the average score of 74. However, there are 18 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
5 Warnings
51 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 73
Failed: 6
Warnings: 1
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Huren voor events - Huren voor events / Alles voor uw event
Length: 59 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 140 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Huren voor Events heeft een uitgebreid assortiment feestmateriaal voor al uw feesten en evenementen. Zowel voor particulieren als bedrijven!
Length: 140 characters
Google Search Results Preview Test
Desktop version
https://hurenvoorevents.be/Huren voor events - Huren voor events / Alles voor uw eventHuren voor Events heeft een uitgebreid assortiment feestmateriaal voor al uw feesten en evenementen. Zowel voor particulieren als bedrijven!
Mobile version
https://hurenvoorevents.be/Huren voor events - Huren voor events / Alles voor uw eventHuren voor Events heeft een uitgebreid assortiment feestmateriaal voor al uw feesten en evenementen. Zowel voor particulieren als bedrijven!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
nl_NL
og:type
website
og:title
Huren voor events - Huren voor events / Alles voor uw event
og:description
Huren voor Events heeft een uitgebreid assortiment feestmateriaal voor al uw feesten en evenementen. Zowel voor particulieren als bedrijven!
og:url
https://hurenvoorevents.be/
og:site_name
Huren voor events
og:image
https://usercontent.one/wp/hurenvoorevents.be/wp-content/uploads/2020/10/Hurenvoorevents.png
og:image:width
300
og:image:height
150
og:image:type
image/png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
29voor15lees14verder11jullie8sierkussen
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
voor
lees
verder
jullie
sierkussen
Keywords Cloud Test
abonneeassortimentbarmateriaalbedanktbeheerbekijkbierglascommunicatiecontactdankdankzijdecoratiedezedienstdienstendiversendoeldoeleindendoorelektrischeventsfijnefruitkistfunctioneelgebruikgebruikergebruiktgedektegeengegevensgemeentehebbenheelhoutenhurenijsemmerinformatiejulliekantoorkerstchaletkeukenmateriaalklantenkoelingkunnenleeslegitiemeleuvenmakenmarketingmateriaalmeermeubilairminutenmultimedianietnodignogmaalsnoodzakelijkonzeopslagprevioussamenwerkingschapenvachtservicesierkussensignalisatiesiteslaanspandoekstatistiekenstatistischetafeltechnischetechnologieëntententevredentijdtitletoegangtoekomsttoestemmingtoiletwagenuitsluitendvanuitverderverlichtingverwarmingverzendenvlottevoorvoorkeurenvouwtentvrijewijnglaswittewordtzaakvoerderzijnzoalszwart
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Welkom bij Huren voor events
H2 tags
ons assortiment
Voor prijzen en meer informatie kan u op de titel van het gewenste product klikken
Niet gevonden wat u zocht? Neem vrijblijvend contact op met ons!
Onze klanten
Wat onze klanten zeggen over ons
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 54
Failed: 9
Warnings: 3
Passed: 13
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,068 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 388.13 Kb to 36.14 Kb (91% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 23.13 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
95.1 %
19.05 Mb
javascript
2.4 %
483.76 Kb
css
1.2 %
248.73 Kb
font
1.1 %
227.68 Kb
html
0.2 %
34.28 Kb
other
0.0 %
693 B
TOTAL
100%
20.03 Mb
Requests by content type
Content type
Percent
Requests
image
54.1 %
93
javascript
26.7 %
46
css
15.1 %
26
font
2.3 %
4
html
1.2 %
2
other
0.6 %
1
TOTAL
100%
172
Content size by domain
Domain
Percent
Size
usercontent.one
90.6 %
18.13 Mb
hurenvoorevents.be
9.3 %
1.86 Mb
fonts.gstatic.com
0.2 %
33.84 Kb
fonts.googleapis.com
0.0 %
1.39 Kb
TOTAL
100%
20.03 Mb
Requests by domain
Domain
Percent
Requests
usercontent.one
82.0 %
141
hurenvoorevents.be
16.9 %
29
fonts.googleapis.com
0.6 %
1
fonts.gstatic.com
0.6 %
1
TOTAL
100%
172
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.085 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.085 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 5.988 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

5.988 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 6.03 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

6.03 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img fetchpriority="high" decoding="async" width="400" height="200" src="https://usercontent.one/wp/hurenvoorevents.be/wp-c..." class="attachment-full size-full wp-image-700" alt="Huren Voor Events" srcset="https://usercontent.one/wp/hurenvoorevents.be/wp-c..." sizes="(max-width: 400px) 100vw, 400px">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.1105. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1105

0.1

0.25

DOM element which contributes the most to CLS score:
Text: ALLE BARMATERIAAL DECORATIE DIVERSEN ELEKTRISCH MATERIAAL GEDEKTE TAFEL KANTOOR ...
Html: <div class="elementor-element elementor-element-d574810 elemen..." data-id="d574810" data-element_type="widget" data-settings="{"columns":"4","columns_tablet":"inherit","columns..." data-widget_type="aux_recent_portfolios_masonry.default">
Score: 0.1105
Server and security
Score: 93
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "hurenvoorevents.be" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.hurenvoorevents.be
Subject Alternative Names (SANs)
*.hurenvoorevents.be, hurenvoorevents.be
Not valid before
Fri, February 23o 2024, 10:46:45 am (z)
Not valid after
Thu, May 23o 2024, 10:46:44 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, viewport-fit=cover" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://hurenvoorevents.be/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://hurenvoorevents.be/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_custspf.one.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved