seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.hindinews.news
Your general SEO Checkup Score
Archived
97/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 97 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
6 Warnings
56 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a Time To First Byte value of 0.8 seconds or less.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
LOW
While a canonical link tag can help in resolving duplicate content issues, it's important to verify that the specified URL is accurate, especially if the site's URL structure has been recently updated.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 77
Failed: 1
Warnings: 3
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 65 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Hindi News, हिंदी न्यूज़, Latest Hindi News, Hindi Samachar, News
Length: 65 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 137 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: ताज़ा हिंदी समाचार, Latest Hindi News, और राष्ट्रीय खबरें. Stay updated with politics, cricket, and entertainment news. भरोसेमंद और तेज़।
Length: 137 characters
Google Search Results Preview Test
Desktop version
https://www.hindinews.news/Hindi News, हिंदी न्यूज़, Latest Hindi News, Hindi Samachar, Newsताज़ा हिंदी समाचार, Latest Hindi News, और राष्ट्रीय खबरें. Stay updated with politics, cricket, and entertainment news. भरोसेमंद और तेज़।
Mobile version
https://www.hindinews.news/Hindi News, हिंदी न्यूज़, Latest Hindi News, Hindi Samachar, Newsताज़ा हिंदी समाचार, Latest Hindi News, और राष्ट्रीय खबरें. Stay updated with politics, cricket, and entertainment news. भरोसेमंद और तेज़।
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Hindi News, हिंदी न्यूज़, Latest Hindi News, Hindi Samachar, News
og:description
ताज़ा हिंदी समाचार, Latest Hindi News, और राष्ट्रीय खबरें. Stay updated with politics, cricket, and entertainment news. भरोसेमंद और तेज़।
og:url
https://www.hindinews.news/home/
og:site_name
Hindi News, हिंदी न्यूज़ , Hindi Samachar, हिंदी समाचार, Latest News in Hindi, Breaking News in Hindi, ताजा ख़बरें
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
27news22result20july16vitamin15hindi
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
news
result
july
vitamin
hindi
Keywords Cloud Test
accountantsafricaaroraattackautomobilebenefitsbonescandidatescategoriescausedcharteredcheckchemotherapyclickconstablecontainingcontentcricketcyberdeficiencydeliverydietdiseaseseducationentertainmenteuroexposesfakefinalfrancefruitshavehealthhealthyhinahindihindinewsicaiimmuneindiaindianinformationinstituteinterjulykhanlaminelatestlaunchlifestylelinkmassagematchmentalmenumessagemishramumbainewsonlinepagephishingphonepolicypoliticspoojapostpriceprivateprotectradharainreadresultscamscamssemifinalshivamskipsourcessouthspainsportsstatessupplementssymptomstagsteamtechnologytoppervarshavastrakarvitaminweatherwomenyadavyamalzimbabweएसएससजलभर
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Vitamin D का महत्व: फायदे, कमी के लक्षण और उपचार
Fake Message : ‘India Post’ से प्राप्त होने वाले Massage से रहें सतर्क
ICAI CA Result 2024: परिणाम जारी, देखें Final Result
SSC GD Constable Result 2024 जारी: यहां चेक करें Exam Result
India vs Zimbabwe 3rd t20, भारत की सीरीज में 2-1 से बढ़त
Spain Vs France :Spain ने France को हराकर फाइनल में प्रवेश किया
IND W VS SA W: भारत ने फाइनल मैच में SA-W को 10 विकेट से हराया
CMF Phone 1: भारत में लॉन्च, जानिए कीमत, स्पेसिफिकेशन्स और ऑफर्स
Mumbai : गंभीर जलभराव, बस और ट्रेन सेवाएं प्रभावित
Hina Khan : पहली Chemotherapy के बाद ही कटवाए बाल
Categories
Hindinews
Quick Links
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 76
Failed: 4
Warnings: 1
Passed: 15
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 15.08 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 539 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 83.44 Kb to 15.08 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.56 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
javascript
43.8 %
104.63 Kb
image
27.2 %
65.03 Kb
css
15.7 %
37.44 Kb
html
13.3 %
31.83 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
238.93 Kb
Requests by content type
Content type
Percent
Requests
css
29.4 %
5
image
29.4 %
5
javascript
23.5 %
4
html
17.6 %
3
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
17
Content size by domain
Domain
Percent
Size
hindinews.news
57.3 %
136.97 Kb
googletagmanager.com
42.7 %
101.96 Kb
TOTAL
100%
238.93 Kb
Requests by domain
Domain
Percent
Requests
hindinews.news
94.1 %
16
googletagmanager.com
5.9 %
1
TOTAL
100%
17
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 3.581 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

3.581 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 4.441 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

4.441 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 4.44 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4.44 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img width="820" height="520" src="https://www.hindinews.news/wp-content/uploads/2024..." class="attachment-full size-full wp-post-image" alt="Vitamin D: Benefits, Deficiency Symptoms and Treat..." itemprop="image" decoding="async" fetchpriority="high" srcset="https://www.hindinews.news/wp-content/uploads/2024..." sizes="(max-width: 820px) 100vw, 820px">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 84
Failed: 1
Warnings: 1
Passed: 5
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "www.hindinews.news" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
cpanel.hindinews.news
Subject Alternative Names (SANs)
cpanel.hindinews.news, hindinews.news, mail.hindinews.news, webdisk.hindinews.news, www.hindinews.news
Not valid before
Mon, May 13o 2024, 4:17:51 am (z)
Not valid after
Sun, August 11o 2024, 4:17:50 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 79
Failed: 3
Warnings: 1
Passed: 5
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.hindinews.news/home/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.hindinews.news/home/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved