seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.healthpoint.ae
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 15 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
3 Warnings
48 Passed
Common SEO issues
Score: 80
Failed: 4
Warnings: 1
Passed: 20
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Hospitals in Abu Dhabi | Specialty Healthcare Provider Abu Dhabi | HealthPoint
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Healthpoint is a specialty health and wellness destination in Abu Dhabi, UAE. We provide the highest standards of healthcare services.Get in touch with us.
Google Search Results Preview Test
Desktop version
https://www.healthpoint.aeHospitals in Abu Dhabi | Specialty Healthcare Provider Abu Dhabi | HealthPointHealthpoint is a specialty health and wellness destination in Abu Dhabi, UAE. We provide the highest standards of healthcare services.Get in touch with us.
Mobile version
https://www.healthpoint.aeHospitals in Abu Dhabi | Specialty Healthcare Provider Abu Dhabi | HealthPointHealthpoint is a specialty health and wellness destination in Abu Dhabi, UAE. We provide the highest standards of healthcare services.Get in touch with us.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Hospitals in Abu Dhabi | Specialty Healthcare Provider Abu Dhabi | HealthPoint
og:description
Healthpoint is a specialty health and wellness destination in Abu Dhabi, UAE. We provide the highest standards of healthcare services.Get in touch with us.
og:image
https://www.healthpoint.ae/media/1843/healthpoint-logo.png
og:url
https://www.healthpoint.ae/en/
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
36healthpoint19better17view16healthpointuae16tweet
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
announcesawardsbariatricbetterbonecareerscentercenterscityclasscliniccomprehensivecoronaviruscoviddentaldentistrydermatologydhabidiagnosticdoctorseventsexecutivefacilitiesfacilityfaqsformfridaygeneralhavehealthhealthcarehealthpointhealthpointuaehelphospitalhoursimaginginformationinitialinitiativeinnovationsinsomniainsuranceinternshipjointskneelivelocationmanagementmanchestermediamedicalmedicinemetabolicmondaymubadalanewsopeningorthopedicspainpartnerpartnerspartnershippatientpatientspharmacyphysiotherapypolicypressprivacyprogramqualityrecognitionrehabilitationrenewalrequestrespiratoryreturnsafetyservicessleepsmilespecialtyspinesportsstudentssundaysurgerysurveillancesurveyteamtimingstipstweetvideosviewvisitvisitorsworldyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
Better Health Together
Move Better
Smile Better
Live Better
Healthpoint Announces Partnership Renewal with Manchester City for A Further Two Years
Return to Healthcare Facility Survey
Coronavirus - (COVID-19) What you need to know
Request Your Medical Records
طلب السجلات الطبية الخاصة بك
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 65
Failed: 6
Warnings: 1
Passed: 13
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 5,482 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 241.6 Kb to 34.18 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 5.62 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
48.3 %
1.83 Mb
javascript
44.8 %
1.70 Mb
font
5.3 %
206.04 Kb
css
1.1 %
42.17 Kb
html
0.5 %
17.86 Kb
other
0.0 %
670 B
TOTAL
100%
3.79 Mb
Requests by content type
Content type
Percent
Requests
image
52.3 %
58
javascript
25.2 %
28
css
7.2 %
8
font
7.2 %
8
html
5.4 %
6
other
2.7 %
3
TOTAL
100%
111
Content size by domain
Domain
Percent
Size
healthpoint.ae
48.4 %
1.84 Mb
pro.fontawesome.com
29.3 %
1.11 Mb
maps.googleapis.com
10.4 %
405.59 Kb
use.typekit.net
3.3 %
129.88 Kb
connect.facebook.net
2.9 %
113.78 Kb
googletagmanager.com
2.3 %
88.67 Kb
fonts.gstatic.com
2.0 %
76.15 Kb
google-analytics.com
0.5 %
19.92 Kb
img.youtube.com
0.3 %
12.54 Kb
sc-static.net
0.2 %
7.60 Kb
Other
0.3 %
10.39 Kb
TOTAL
100%
3.79 Mb
Requests by domain
Domain
Percent
Requests
healthpoint.ae
43.2 %
48
maps.googleapis.com
26.1 %
29
tr.snapchat.com
4.5 %
5
use.typekit.net
3.6 %
4
fonts.gstatic.com
3.6 %
4
fonts.googleapis.com
2.7 %
3
googletagmanager.com
1.8 %
2
connect.facebook.net
1.8 %
2
facebook.com
1.8 %
2
maps.gstatic.com
1.8 %
2
Other
9.0 %
10
TOTAL
100%
111
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 71
Failed: 3
Warnings: 0
Passed: 6
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.healthpoint.ae" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.healthpoint.ae
Organization
HEALTH POINT HOSPITAL L.L.C
Location
Abu Dhabi, Abu Dhabi, AE
Subject Alternative Names (SANs)
*.healthpoint.ae, healthpoint.ae
Not valid before
Thu, December 16o 2021, 6:17:01 am (z)
Not valid after
Mon, January 9o 2023, 9:36:07 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign RSA OV SSL CA 2018
Intermediate certificate
Common name
GlobalSign RSA OV SSL CA 2018
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, November 21o 2018, 12:00:00 am (z)
Not valid after
Tue, November 21o 2028, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Root certificate
Common name
GlobalSign
Organization
GlobalSign
Not valid before
Wed, March 18o 2009, 10:00:00 am (z)
Not valid after
Sun, March 18o 2029, 10:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 75
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.healthpoint.ae/en/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.healthpoint.ae/en/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 a mx -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved