seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://www.furl.co.uk/storage-beds
Your general SEO Checkup Score
Archived
75/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 75 out of 100, which is the same as the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
2 Warnings
29 Passed
Common SEO issues
Score: 72
Failed: 3
Warnings: 1
Passed: 11
Google Search Results Preview
Desktop version
http://www.furl.co.uk/storage-beds/Luxury Storage Beds - FurlThe Storage Bed Company is the UK's #1 storage & ottoman bed provider. Quality leather, fabric & wooden storage beds, hand-made to fit your requirements
Mobile version
http://www.furl.co.uk/storage-beds/Luxury Storage Beds - FurlThe Storage Bed Company is the UK's #1 storage & ottoman bed provider. Quality leather, fabric & wooden storage beds, hand-made to fit your requirements
Keywords Cloud
appointmentbeautifulbedsbespokeblogbreakfastcan’tclassicclevercolourscomecontactcontemporarycreditcustomcustomer'sdecemberdeepdeliverydesigndesigningdeskdifferentfabricfabricsflatmatefreegettinghackshappyhardhighhousesi'veimageinfographicingeniouslyintroducinglatestlazyleatherleatherslongingluxuriousmakemakingmattressmonthsmuchlovednewsnovembernumberofferoptionsorderottomanperfectpricesproductproductsqualityquiterangerangesreadrightsamplessavingserviceshareshowroomsimplysitesleighsnowsnugglesolidspacespecialisestandardstoragestylestylesstylishthere'sthoughtvarietyviewwatchingwe'rewe'vewearingweekendswindowwinterwoodworkworkingworldwouldn't
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
SEO Friendly URL Test
  • This analyzed URL is SEO friendly but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 37 'img' tags and 17 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 51 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • We've found a favicon in your page's HTML code but it's not accessible.
JS Error Checker
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Social Media Check
Speed optimizations
Score: 80
Failed: 2
Warnings: 1
Passed: 7
HTML Page Size Test
  • Congratulations! Your HTML size is 11.98 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 42.94 Kb to 11.98 Kb (72 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 23.344 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 100
  • 15 HTML Pages
  • 7 CSS Files
  • 22 JS Files
  • 56 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
Server and security
Score: 80
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 12 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 75
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved