seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.flushheating.co.uk
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
1 Warnings
39 Passed
Common SEO issues
Score: 91
Failed: 2
Warnings: 0
Passed: 19
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Flush Heating & Plumbing - London Plumbers, Boiler Services & Installs
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Flush Heating & Plumbing are trusted 5 star rated London Plumbers, offering one off plumbing, heating, drain & leak repairs - no matter how big or small the job. Gas Safety Approved, Checkatrade & Which Approved. Call 07841 717 126.
Google Search Results Preview
Desktop version
https://www.flushheating.co.ukFlush Heating & Plumbing - London Plumbers, Boiler Services & InstallsFlush Heating & Plumbing are trusted 5 star rated London Plumbers, offering one off plumbing, heating, drain & leak repairs - no matter how big or small the job. Gas Safety Approved, Checkatrade & Which Approved. Call 07841 717 126.
Mobile version
https://www.flushheating.co.ukFlush Heating & Plumbing - London Plumbers, Boiler Services & InstallsFlush Heating & Plumbing are trusted 5 star rated London Plumbers, offering one off plumbing, heating, drain & leak repairs - no matter how big or small the job. Gas Safety Approved, Checkatrade & Which Approved. Call 07841 717 126.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
54heating34flush21plumbing11london10service
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
ableavailablebalhambandbasedbathroomboilerbrixtonbusinessescentralcertificatecertificationcertifiedcheckclaphamcompletelycontactcostcountcustomersdrainemailemergenciesemergencyengineersexperienceexpertsflatflushfreefriendlyfullyhandleheatinghomeincludesincludingindustryinfo@flushheating.co.ukinstallinstallationinstallationsinsuredknowlandlordlatestlicensedlocallocationslondonlookmenuneedneedspartsphonepipeplumbersplumbingpowerpricepricesprofessionalprovidequalityquotereadregisteredrepairrepair/replacementrepairsreplacementreplacementsreviewsrightsafesafetyscheduledserviceservicesservicingservingshowersolarsouthspeaksstandsystemstestimonialsthere'sthey'lltrainingunderstandwandsworthwaterwe'reworkyearsyou'llyou've
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Flush Heating & Plumbing - Local South London Plumbers
H2 tags
10% off
b Central Heating
a Boiler Replacements
o Bathroom
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 57
Failed: 5
Warnings: 1
Passed: 7
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 23.14 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 72% - from 23.14 Kb to 6.39 Kb .
Site Loading Speed Test
  • Your website loading time is around 3.08 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 30
  • 1 HTML Pages
  • 9 CSS Files
  • 6 JS Files
  • 14 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 8 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:145.239.201.17 ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved