seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://www.farmcamps.nl
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 15 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
15 Failed
2 Warnings
34 Passed
Common SEO issues
Score: 82
Failed: 3
Warnings: 0
Passed: 14
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Hooi Hooi! Luxe logeren bij de boer | FarmCamps
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Luxe logeren bij de boer. Een ruime accommodatie met eigen toilet en badkamer! Boek een boerderijvakantie bij FarmCamps ✓Ruime tenten ✓Fijn weer garantie!
Google Search Results Preview Test
Desktop version
https://www.farmcamps.nlHooi Hooi! Luxe logeren bij de boer | FarmCampsLuxe logeren bij de boer. Een ruime accommodatie met eigen toilet en badkamer! Boek een boerderijvakantie bij FarmCamps ✓Ruime tenten ✓Fijn weer garantie!
Mobile version
https://www.farmcamps.nlHooi Hooi! Luxe logeren bij de boer | FarmCampsLuxe logeren bij de boer. Een ruime accommodatie met eigen toilet en badkamer! Boek een boerderijvakantie bij FarmCamps ✓Ruime tenten ✓Fijn weer garantie!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19farmcamps13luxe6boer5voor4pinksteren
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
aankomstdatumaccommodatiesactiecodeallealvastaprilaugustusbarntentboekboerboerderijboerderijenboerenbrabantcontactdecemberdoordrentheextrafamiliefamilievakantiefarmcampsfarmtentfebruarifijnfrieslandgarantiegastgelderlandglampinggroepheerlijkhelehemelvaarthemelvaartweekendherfstvakantiehollandhomejaarjanuarijouwjulijunikinderfeestjeklaskortkorteleukerleukstelimburglodgetentluxemaarmaartmeivakantiemidweeknaarnachtennederlandnoordnovemberoktoberonzepaardenvakantiepaasweekendpasenperiodespinksterenpinksterweekendponypopulaireprovincieranchtentreserveersafaritentselecteerseptemberslaaptentthuisuitgelichtvakantiesvasteverblijfsduurvergelijkvoorvriendenvrijwaarwaaromweekweekendweekendjeweerwekenzeelandzoekzoektzomervakantiezuid
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Populaire periodes
H2 tags
Zoek & boek de leukste familievakantie van Nederland
Uitgelicht
Reactie van Familie Cuijpers
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 18
Failed: 8
Warnings: 2
Passed: 1
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 71% - from 114.99 Kb to 33.4 Kb .
Site Loading Speed Test
  • Your website loading time is around 3.91 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 58
  • 1 HTML Pages
  • 9 CSS Files
  • 17 JS Files
  • 31 Images
  • 0 Flash Files
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 56
Failed: 1
Warnings: 0
Passed: 6
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.farmcamps.nl is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.farmcamps.nl" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:spf.protection.outlook.com include:maxxton.com include:spf.maxxton.com include:emsd1.com ip4:40.107.3.131 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved