seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.earthhospital.co.in
Your general SEO Checkup Score
Archived
71/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 71 out of 100, which is below the average score of 75. However, there are 9 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
9 Failed
5 Warnings
36 Passed
Common SEO issues
Score: 77
Failed: 3
Warnings: 3
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 95 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Ayurveda Treatment : Paralysis | Arthritis | Infertility | back pain | Cochin, Bangalore, Delhi
Length: 95 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Ayurvedic hospital providing Natural, safe and effective treatment for Arthritis, Infertility, Paralysis, Back pain at Kottayam, Cochin, Bangalore and Delhi.
Length: 157 characters
Google Search Results Preview Test
Desktop version
https://www.earthhospital.co.inAyurveda Treatment : Paralysis | Arthritis | Infertility | back pain | Cochin, Bangalore, DelhiAyurvedic hospital providing Natural, safe and effective treatment for Arthritis, Infertility, Paralysis, Back pain at Kottayam, Cochin, Bangalore and Delhi.
Mobile version
https://www.earthhospital.co.inAyurveda Treatment : Paralysis | Arthritis | Infertility | back pain | Cochin, Bangalore, DelhiAyurvedic hospital providing Natural, safe and effective treatment for Arthritis, Infertility, Paralysis, Back pain at Kottayam, Cochin, Bangalore and Delhi.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Kurias Earth Multi-Speciality Ayurveda Hospital
og:url
https://earthhospital.co.in
og:image
https://www.earthhospital.co.in/ogearthlogo.png
og:site_name
Kurias Earth Hospital
og:description
Multispeciality hospital for ayurveda treatment
og:image:type
image/png
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
25earth19hospital11treatment11kurias9ayurveda
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
earth
hospital
treatment
kurias
ayurveda
Keywords Cloud Test
addictionallergicanishappointmentarthritisattendingayurvedabangalorebanglorebrandcareceremonychairmanchroniccompleteconceptsconnectedconsultingcontactcuredelhidiseasedisordersdoctordoctorsearthearthhospitaleffectiveemailexperiencefamilyfranchisegenerationsgrouphavehealingheldhomehospitalhospitalsinaugurationindiainfertilityjointjointskarnatakakeralakuriaslayoutlikelivesmakemarchmediamedicalmobilemonomedimultimultipsecialitynaturalnetworknewsnovemberoctoberonlineovarianpackagespainparalysispatientpatientspermanentlyproblemsprofilepulserenownedrhinitissafeskinspecialspecialitiesspecialityspecializedspondylitisstagesstartedstiffnesssufferingsupersyndrometeamtechniquetestimonialsthankingthyroidtraditionaltreatmenttreatmentsvisitingyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Paralysis
Arthritis
Back pain & spinal disorders
Infertility Treatment
H2 tags
The one and only hospital that have special treatment for Paralysis. Multiple sclerosis, one side paralysis, upper motor neuron leision, TB of spine and brain, genetic disorders, bone and joint disorders, immobility due to tendon-ligament injuries and disorders, traumatic paralysis, facial paralysis and paralytic conditions of all age groups are treated here.
Are you suffering from Joint pain, morning stiffness, swelling in joints? Are joints becoming more painful in cold and dump weather? Do you have symptoms of mild body temperature and loss of appetite. It is notable that is these are not taken care of properly at the initial stages, the joints become immobile and may also become permanently deformed. We at Earth provide Natural, safe and effective treatment for Arthritis.
Are you suffering from persistent dull or sharp pain over the lower back? or are you suffering from burning, stiffness, numbness or tingling with the pain shooting down the buttocks and the legs? 70% of the people suffer from low back pain at some time in their lives. Our eminent and specialist doctors are always available to help you. Make a visit to Earth Hospital.
Effective treatment for Infertility, Polycystic Ovarian Syndrome, Endometiosis, Fallopian tubal blocks, fibroid uterus, Ovarian cysts, Stress Oligospermia (Less sperm count), Asthenospermia (Less motility of sperms) etc. Specialized gynecological Panchakarma treatments like Uttarbasti, Basti, Nasya, Yonidhavana, Yonipichu are done at out Hospital.
Dr. Anish M Kurias
News Room Earth News
What our patients says
Make an appointment
Featured Packages
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 66
Failed: 5
Warnings: 1
Passed: 12
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 8.78 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 20,084 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 44.02 Kb to 8.78 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 40.18 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 5.08 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.08 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Paralysis The one and only hospital that have special treatment for Paralysis. M...
Html: <li style="background-image: url("images/paralysis.jpg"); wid..." class="flex-active-slide" data-thumb-alt="">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.001. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0009

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <span class="icon">
Score: 0.0004
Advanced SEO
Score: 50
Failed: 1
Warnings: 1
Passed: 5
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://earthhospital.co.in/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://earthhospital.co.in/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file disallow the search engines access to some parts of your website! You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:158.69.53.72 +ip4:119.81.4.114 ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved