seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://www.diabeticfootindia.org
Your general SEO Checkup Score
Archived
96/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 96 out of 100, which is higher than the average score of 75. Our analysis has identified 13 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
1 Warnings
44 Passed
Common SEO issues
Score: 74
Failed: 4
Warnings: 0
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Clinic For Diabetic Foot in Mumbai - Diabetic Foot Clinic India
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Diabetic Foot Clinic, Mumbai, India is a need based clinic. Our prompt diabetic foot treatment can make a difference between saving a foot or losing a foot.
Google Search Results Preview Test
Desktop version
https://www.diabeticfootindia.orgClinic For Diabetic Foot in Mumbai - Diabetic Foot Clinic IndiaDiabetic Foot Clinic, Mumbai, India is a need based clinic. Our prompt diabetic foot treatment can make a difference between saving a foot or losing a foot.
Mobile version
https://www.diabeticfootindia.orgClinic For Diabetic Foot in Mumbai - Diabetic Foot Clinic IndiaDiabetic Foot Clinic, Mumbai, India is a need based clinic. Our prompt diabetic foot treatment can make a difference between saving a foot or losing a foot.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11foot8rege6patients5diabetic3diabetes
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
amputationsappointmentapproachavoidblogbloodbookcalluscarecellulitischaritycheckclinicscomplicationscontactcornscounselleddetectiondevidasdiabetesdiabeticdietdifficultdressersdressingdressingsearlyeventseverydayexaminationfeetfitnessfootfootwearformationfranklygallerygangrenehappyhavehomeincludingindiaindividualizedinfectionslifelikelittlemajormakemanagingmastersmeetmobilizingmonthsmumbainaiknormaloccurredoffloadonespatientpatientsplanplayspointspressureproblemsqualifiedregerequirerequiredriskroleroutinesavesavedsentservicesseveresolesspeakingspeciallystoriessuccesssugarssuggestedsuhassurgeonsurgeriessurgicalswellingteamtotallytrainedtreattreatmenttusharwalkyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Speed optimizations
Score: 62
Failed: 5
Warnings: 1
Passed: 5
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 16.21 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 69.96 Kb to 16.21 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 29.28 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
63.7 %
1.63 Mb
javascript
23.4 %
610.34 Kb
css
8.0 %
207.96 Kb
font
3.1 %
80.62 Kb
html
1.4 %
36.18 Kb
other
0.5 %
12.92 Kb
TOTAL
100%
2.55 Mb
Requests by content type
Content type
Percent
Requests
image
37.1 %
56
javascript
33.1 %
50
css
21.9 %
33
other
3.3 %
5
html
2.6 %
4
font
2.0 %
3
TOTAL
100%
151
Content size by domain
Domain
Percent
Size
diabeticfootindia.org
63.6 %
1.62 Mb
google.com
21.3 %
556.39 Kb
maps.googleapis.com
9.5 %
246.96 Kb
maps.gstatic.com
2.8 %
71.86 Kb
fonts.gstatic.com
1.2 %
31.60 Kb
google-analytics.com
0.8 %
19.92 Kb
khms0.googleapis.com
0.5 %
12.49 Kb
khms1.googleapis.com
0.3 %
7.96 Kb
fonts.googleapis.com
0.1 %
3.70 Kb
TOTAL
100%
2.55 Mb
Requests by domain
Domain
Percent
Requests
diabeticfootindia.org
51.0 %
77
google.com
29.8 %
45
maps.googleapis.com
9.9 %
15
fonts.googleapis.com
3.3 %
5
maps.gstatic.com
2.6 %
4
fonts.gstatic.com
1.3 %
2
google-analytics.com
0.7 %
1
khms0.googleapis.com
0.7 %
1
khms1.googleapis.com
0.7 %
1
TOTAL
100%
151
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 74
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
SSL Checker and HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • This webpage is using mixed content! While the initial HTML is loaded over a secure HTTPS connection, other resources (such as images, videos, stylesheets, scripts) may be loaded over an insecure HTTP connection, which may result in blocked content or unexpected page behavior.
See results list
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 0
Passed: 7
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.diabeticfootindia.org is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.diabeticfootindia.org/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved