seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.coachhirelondon.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 115 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
3 Warnings
40 Passed
Common SEO issues
Score: 96
Failed: 0
Warnings: 1
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Coach & Mini Bus Hire In London | Reliable Transport by Mayday Travel
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Hire a coach or mini bus in London. Available for all types of occasions including corporate travel, airport transfers and many more. Get a free quote today
Google Search Results Preview Test
Desktop version
https://www.coachhirelondon.co.ukCoach & Mini Bus Hire In London | Reliable Transport by Mayday TravelHire a coach or mini bus in London. Available for all types of occasions including corporate travel, airport transfers and many more. Get a free quote today
Mobile version
https://www.coachhirelondon.co.ukCoach & Mini Bus Hire In London | Reliable Transport by Mayday TravelHire a coach or mini bus in London. Available for all types of occasions including corporate travel, airport transfers and many more. Get a free quote today
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
16hire15coach8occasions8passenger8transport
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accommodateairportairportsareaareasarriveassignedavailabilityblogboatbusycallbackcarefullyclientsclubscoachcoachescomfortableconferencescontactcontractcorporatecoverdriversdropefficienteliteemailemergencyenquireensureeuropeexhibitionsexperiencedextrasfamilyfittedfleetfuneralsgreatgroupshandhirehomeidealjourneyjourneysknowledgeablelargelondonluxurymakemaydaymeetingsmenuminineedsoccasionsoffersoptionspassengerpassengerspeoplepickupplannedplanningpossibleprivateprovidingquotationrangeregularrelaxedreliablereplacementrequestsafesafelyscalescheduleschoolserviceservicesshuttlespecialsportingtermstimetraintransferstransporttraveltriptripstrustpilotvehicleswakesweddingswidgetwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Coach Hire In London!
H2 tags
Welcome to Mayday Travel Ltd, the family run providers of safe and reliable passenger transport for all occasions.
Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 66
Failed: 3
Warnings: 1
Passed: 7
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 26.48 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 159.25 Kb to 26.48 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.56 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 104
  • 4 HTML Pages
  • 23 CSS Files
  • 39 JS Files
  • 38 Images
  • 0 Flash Files
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 67
Failed: 1
Warnings: 1
Passed: 1
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 2
Warnings: 0
Passed: 4
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.coachhirelondon.co.uk is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.coachhirelondon.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved