seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://www.catamaran.guide
Your general SEO Checkup Score
Archived
90/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 90 out of 100, which is higher than the average score of 75. Our analysis has identified 14 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
2 Warnings
25 Passed
Common SEO issues
Score: 76
Failed: 2
Warnings: 1
Passed: 9
Google Search Results Preview
Desktop version
http://www.catamaran.guide/page/page/9018789.htmTHE CATAMARAN EXPERIENCED / HANDLING THE CATAMARAN SAILINGCatamaran.Guide is a resource site for the catamaran owner, displaying different catamaran sailing/handling related topics as well as offering related products.
Mobile version
http://www.catamaran.guide/page/page/9018789.htmTHE CATAMARAN EXPERIENCED / HANDLING THE CATAMARAN SAILINGCatamaran.Guide is a resource site for the catamaran owner, displaying different catamaran sailing/handling related topics as well as offering related products.
Keywords Cloud
advantagesamazon.co.ukamazon.comanchoredanchoringareaattentivelyavailablebeachedbeachesbeautifulbestselboatbondedbookcatamarancatamaranscentercharterschartscommencecompanionscomparedcomponentsconsideringcoursecrewcriticaldeckdeepdestinationsdevelopeddreamlikeeasiereasilyemergencyequipmentespeciallyeuropeeventualexperiencedexperiencesfactorsfallingfamilyflexibilityforecfriendsgreathandleheelingimportantindianinstancekeellifelittlelogslongmakesmarinasmarinemaru”meaningmembers/friendsmonohullsnavigationniceobviousofferingoffersordinaryoriginallyoutdooroverboardproductsreefingregardingresourcesriskysafesafetysailsailingshallowshiftspacetermtodayundisturbedusedwatcheswaterwatersweatherwestwordworldworrisome”kata
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
Image Alt Test
  • Your webpage has 10 'img' tags and 4 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • We've found a favicon in your page's HTML code, but it's not accessible.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 27
Failed: 4
Warnings: 1
Passed: 1
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 74 % - from 26.86 Kb to 7.04 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 6.071 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 49
  • 8 HTML Pages
  • 4 CSS Files
  • 20 JS Files
  • 17 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
URL Redirects Checker
  • Your URL performed one redirect! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 73
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved