seo site checkup logo
PricingFree ToolsArticles
Report generated 6 months ago
https://www.businesstoday.in
Your general SEO Checkup Score
Archived
95/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 95 out of 100, which is higher than the average score of 75. Our analysis has identified 14 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
3 Warnings
55 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 74
Failed: 3
Warnings: 3
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 70 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Business News India: Latest Business News Today, Share Market, Economy
Length: 70 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Business News Today: Get latest business news from India, breaking business news updates, live share market news today, trending business news, stocks, IPO, finance, economy, crypto stories on Business Today.
Length: 208 characters
Google Search Results Preview Test
Desktop version
https://www.businesstoday.in/Business News India: Latest Business News Today, Share Market, EconomyBusiness News Today: Get latest business news from India, breaking business news updates, live share market news today, trending business news, stocks, IPO, finance, economy, crypto stories on Business Today.
Mobile version
https://www.businesstoday.in/Business News India: Latest Business News Today, Share Market, EconomyBusiness News Today: Get latest business news from India, breaking business news updates, live share market news today, trending business news, stocks, IPO, finance, economy, crypto stories on Business Today.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Business Today
og:title
Business News India: Latest Business News Today, Share Market, Economy
og:description
Business News Today: Get latest business news from India, breaking business news updates, live share market news today, trending business news, stocks, IPO, finance, economy, crypto stories on Business Today.
og:url
https://www.businesstoday.in/
og:image
https://akm-img-a-in.tosshub.com/businesstoday/resource/img/home-share.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
45india23today18fund17view16price
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
india
today
fund
view
price
Keywords Cloud Test
adaniairlineaprilattackautoaviationbankbankingbestbusinessbuzzcalculatorcategorychatgptcommoditiescompanycornercorporatecovercroredatedeepdirectdriveeconomyeducationenergyequityestateflexiflightfuelledfundfundsglobalgrowthhdfchighhomeindiaindigoindustryinternationalinvestmentissuelakhlatestleadershiplistmagazinemarketmillionmodimoneymotorsmutualnewsniftypahalgampakistanpathpharmaplanpowerpriceprofitraiserankrealrecordreportresultsreturnreturnsriskroutessectorseeksshareshortssizesmallspecialstocksstoriesstorystudentssubscribetatatechterrortodaytrendingviewvisualwarnswavesyearyearszomato
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Business News
H2 tags
COMPANIES
NEWS
'Not software, but imagination': Adobe CEO bets on AI-fuelled creativity to drive India’s growth
Cover Story
Corporate
Stocks
US News
Tax
Economy
News
Editor's Note
Deep Dive
Columns
Interview
Just In
Trending Stocks
IPO Corner
Crypto Corner
Commodities
Global Markets
Market Buzz
UnboxToday
TechDeck
AuthenTech
Mutual Funds
Investment
Insurance
Retirement Planning
Real Estate
BEST MUTUAL FUNDS
TRENDING
SBI shares fell 3% to ₹784.45 on BSE amid profit booking
Bank plans to raise equity capital for business growth this year
Board meeting on 3 May to discuss and approve equity raise
Visual Stories
SECTORS
CALCULATORS
BT TV TOP VIDEOS
Industry News
Banking
Auto
IT
Pharma
Energy
Telecom
View All
OTHER NEWS
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 65
Failed: 8
Warnings: 0
Passed: 12
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,487 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1913.46 Kb to 348.46 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.33 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
47.0 %
4.60 Mb
javascript
25.6 %
2.50 Mb
other
15.0 %
1.47 Mb
html
10.5 %
1.03 Mb
font
1.6 %
160.64 Kb
css
0.3 %
26.14 Kb
TOTAL
100%
9.79 Mb
Requests by content type
Content type
Percent
Requests
image
40.7 %
160
javascript
25.2 %
99
other
16.5 %
65
html
12.2 %
48
font
3.1 %
12
css
2.3 %
9
TOTAL
100%
393
Content size by domain
Domain
Percent
Size
staticassets-creator-design.criteo.net
24.8 %
2.42 Mb
akm-img-a-in.tosshub.com
20.9 %
2.05 Mb
bttvlive-amd.akamaized.net
12.2 %
1.19 Mb
securepubads.g.doubleclick.net
6.6 %
661.30 Kb
imasdk.googleapis.com
4.0 %
405.13 Kb
imageproxy.us.criteo.net
4.0 %
397.80 Kb
ads.us.criteo.com
3.9 %
386.20 Kb
businesstoday.in
3.5 %
350.74 Kb
ssl.p.jwpcdn.com
2.6 %
265.43 Kb
googletagmanager.com
2.5 %
252.23 Kb
Other
15.0 %
1.47 Mb
TOTAL
100%
9.79 Mb
Requests by domain
Domain
Percent
Requests
akm-img-a-in.tosshub.com
37.4 %
147
google.com
2.8 %
11
fonts.gstatic.com
2.5 %
10
cf-img-a-in.tosshub.com
2.5 %
10
fundingchoicesmessages.google.com
2.5 %
10
ads.us.criteo.com
2.5 %
10
cat.us5.us.criteo.com
2.5 %
10
measurement-api.criteo.com
2.5 %
10
csm.us.criteo.net
2.5 %
10
static.criteo.net
2.3 %
9
Other
39.7 %
156
TOTAL
100%
393
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.046 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.046 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.830 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.83 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.42 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.42 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img width="446" height="251" src="https://akm-img-a-in.tosshub.com/businesstoday/ima..." alt="India, he added, is poised to lead with ethical AI..." title="India, he added, is poised to lead with ethical AI...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0050. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.005

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Apr 30, 2025, 3:47 PM SBI shares drop 3% amid plans for equity capital raise SBI...
Html: <div>
Score: 0.0019
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.businesstoday.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.businesstoday.in
Subject Alternative Names (SANs)
akm-img-a-in.tosshub.com, alpha-telugu-it.intoday.in, appfeeds.intoday.in, atappfeeds.intoday.in, auth.indiatoday.in, bangla.aajtak.in, bazaar.businesstoday.in, blog.indiacontent.in, businesstoday.in, conclave.intoday.in, cosmoappfeeds.intoday.in, cosmopolitan.in, dailyo.in, dailyoappfeeds.intoday.in, electionresult.intoday.in, electionresults.intoday.in, electiontak.in, embed-bangla.aajtak.in, embed-bazaar.businesstoday.in, embed-hindi.web3cafe.in, embed-malayalam.indiatoday.in, embed.bridestoday.in, embed.businesstoday.in, embed.cosmopolitan.in, embed.indiatodaytelugu.com, embed.thetrendingtoday.com, embed.web3cafe.in, feeds.intoday.in, hindi.web3cafe.in, ichowk.in, ichowkappfeeds.intoday.in, indiacontent.in, indiatodaytelugu.com, intdy.in, lingoappfeeds.intoday.in, m.businesstoday.in, malayalam.indiatoday.in, media2.intoday.in, opinion.intoday.in, pgateway.intoday.in, play.indiatodaygaming.com, podcasts.aajtak.in, recengine.intoday.in, results.intoday.in, smedia2.intoday.in, specials.digitaltoday.in, specials.indiatoday.com, specials.intoday.in, sports-feeds.intoday.in, subscription.readersdigest.in, subscriptions.intoday.in, syndfeeds.intoday.in, thetrendingtoday.com, vsfeed.intoday.in, web3cafe.in, www.aajtakhd.com, www.aajtaklite.com, www.bridestoday.in, www.businesstoday.in, www.caretoday.in, www.cosmopolitan.in, www.dailyo.in, www.electiontak.in, www.ichowk.in, www.ideaplex.in, www.indiacontent.in, www.indiatodaygaming.com, www.indiatodaytelugu.com, www.lovesutras.com, www.oddnaari.in, www.pakwangali.in, www.readersdigest.co.in, www.readersdigest.in, www.thetrendingtoday.com, www.web3cafe.in
Not valid before
Tue, March 18o 2025, 9:37:34 am (z)
Not valid after
Mon, June 16o 2025, 9:37:33 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R10
Intermediate certificate
Common name
R10
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=15768000
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, minimum-scale=1.0, maximum-scale=5.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 96
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.businesstoday.in/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.businesstoday.in/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.protection.outlook.com -all
Ads.txt Validation Test67% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but its content has invalid records! Having errors in this file would cause advertisers to not recognize and ignore the authorized sellers list and that will lead to lost revenue.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved