seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.barcindia.co.in
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 85 out of 100, which is higher than the average score of 75. Our analysis has identified 15 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
15 Failed
1 Warnings
32 Passed
Common SEO issues
Score: 75
Failed: 3
Warnings: 1
Passed: 13
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Television Audience Measurement India | Set Top Box Analytics
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: TV Audience Measurement: BARC helps to analyze TRP of TV Serials, shows and movies. We solved the puzzled of Television(TV) Analytics of India which is much needed.
Google Search Results Preview
Desktop version
http://www.barcindia.co.inTelevision Audience Measurement India | Set Top Box AnalyticsTV Audience Measurement: BARC helps to analyze TRP of TV Serials, shows and movies. We solved the puzzled of Television(TV) Analytics of India which is much needed.
Mobile version
http://www.barcindia.co.inTelevision Audience Measurement India | Set Top Box AnalyticsTV Audience Measurement: BARC helps to analyze TRP of TV Serials, shows and movies. We solved the puzzled of Television(TV) Analytics of India which is much needed.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
67news35star32india22sony21movies
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
actionadvertisersagenciesanmolannouncementsasianetassamaudiencebanglabarcbharatbhojpuribiharboardbroadcastbroadcasterscalendarcentercertificationchannelchannelscinemaclickcnbccollectcolorscomedycommitteedatadescriptiondifferentiatorsdirectorsdiscoverydisneyfaqsgeminiglossarygoldgujaratiharyanahindihomeindiajalshajayakannadalifelivemadhyamanagementmarathimediamegamethodologymoviesmusicnationalndtvnewsnewsletternewslettersnickonlinepluspradeshprimepromoterspuzzlerajasthanresourcesroadshowsaharasamacharsamaysangeetselectsizesonysportsstarsupersuryasuvarnatamilteamtechnicaltechnologytelevisiontelugutermsthinktimetimesudayaupdatesviewwatermarkedweekweeklyworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Welcome to BARC India
The BARC India Newsletter
Click here for Road Show PPT
Broadcasters with WM Technology
Weekly datA
Promoters
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 19
Failed: 6
Warnings: 0
Passed: 2
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 53% - from 79.63 Kb to 37.31 Kb .
Site Loading Speed Test
  • Your website loading time is around 4.36 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 61
  • 1 HTML Pages
  • 7 CSS Files
  • 17 JS Files
  • 36 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 73
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:_spf.google.com include:spf.protection.outlook.com ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved