seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.barcindia.co.in
Your general SEO Checkup Score
Archived
64/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 64 out of 100, which is below the average score of 75. However, there are 14 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
14 Failed
1 Warnings
34 Passed
Common SEO issues
Score: 68
Failed: 5
Warnings: 1
Passed: 15
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Television Audience Measurement India | Set Top Box Analytics
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: TV Audience Measurement: BARC helps to analyze TRP of TV Serials, shows and movies. We solved the puzzled of Television(TV) Analytics of India which is much needed.
Google Search Results Preview
Desktop version
http://www.barcindia.co.inTelevision Audience Measurement India | Set Top Box AnalyticsTV Audience Measurement: BARC helps to analyze TRP of TV Serials, shows and movies. We solved the puzzled of Television(TV) Analytics of India which is much needed.
Mobile version
http://www.barcindia.co.inTelevision Audience Measurement India | Set Top Box AnalyticsTV Audience Measurement: BARC helps to analyze TRP of TV Serials, shows and movies. We solved the puzzled of Television(TV) Analytics of India which is much needed.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
67news35star32india22sony21movies
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
actionadvertisersagenciesanmolannouncementsasianetassamaudiencebanglabarcbharatbhojpuribiharboardbroadcastbroadcasterscalendarcentercertificationchannelchannelscinemaclickcnbccollectcolorscomedycommitteedatadescriptiondifferentiatorsdirectorsdiscoverydisneyfaqsgeminiglossarygoldgujaratiharyanahindihomeindiajalshajayakannadalifelivemadhyamanagementmarathimediamegamethodologymoviesmusicnationalndtvnewsnewsletternewslettersnickonlinepluspradeshprimepromoterspuzzlerajasthanresourcesroadshowsaharasamacharsamaysangeetselectsizesonysportsstarsupersuryasuvarnatamilteamtechnicaltechnologytelevisiontelugutermsthinktimetimesudayaupdatesviewwatermarkedweekweeklyworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Welcome to BARC India
The BARC India Newsletter
Click here for Road Show PPT
Broadcasters with WM Technology
Weekly datA
Promoters
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 42
Failed: 6
Warnings: 0
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 53% - from 79.63 Kb to 37.31 Kb .
Site Loading Speed Test
  • Your website loading time is around 4.36 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 61
  • 1 HTML Pages
  • 7 CSS Files
  • 17 JS Files
  • 36 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 74
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Microsoft-IIS/8.5
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:_spf.google.com include:spf.protection.outlook.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved