seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://www.asyst.co.id
Your general SEO Checkup Score
Archived
70/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 70 out of 100, which is below the average score of 75. However, there are 19 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
19 Failed
2 Warnings
36 Passed
Common SEO issues
Score: 55
Failed: 6
Warnings: 1
Passed: 13
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Home - PT Aero Systems Indonesia
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: PT Aero Systems Indonesia, formerly known as PT Lufthansa Systems Indonesia, was established in 2005. At the beginning, PT Garuda Indonesia (Persero) owned 51% shares in this company,while the remaining 49% was owned by Lufthansa System AG (LSY). On January 29, 2009 there was a transfer of share ownership from LSY to PT Aero Wisata. The proven skills and experience of our people, and complementary international partners, enable Asyst to successfully design, build, deliver and support information systems. We successfully demonstrate our commitment to execute, our desire to be proactive in addressing our clients' needs and how we help enterprises to gain a significant competitive advantage. We are committed to earning the position of trusted adviser, addressing our clients' strategic business issues with Information and Technology services.
Google Search Results Preview Test
Desktop version
https://www.asyst.co.idHome - PT Aero Systems IndonesiaPT Aero Systems Indonesia, formerly known as PT Lufthansa Systems Indonesia, was established in 2005. At the beginning, PT Garuda Indonesia (Persero) owned 51% shares in this company,while the remaining 49% was owned by Lufthansa System AG (LSY). On January 29, 2009 there was a transfer of share ownership from LSY to PT Aero Wisata. The proven skills and experience of our people, and complementary international partners, enable Asyst to successfully design, build, deliver and support information systems. We successfully demonstrate our commitment to execute, our desire to be proactive in addressing our clients' needs and how we help enterprises to gain a significant competitive advantage. We are committed to earning the position of trusted adviser, addressing our clients' strategic business issues with Information and Technology services.
Mobile version
https://www.asyst.co.idHome - PT Aero Systems IndonesiaPT Aero Systems Indonesia, formerly known as PT Lufthansa Systems Indonesia, was established in 2005. At the beginning, PT Garuda Indonesia (Persero) owned 51% shares in this company,while the remaining 49% was owned by Lufthansa System AG (LSY). On January 29, 2009 there was a transfer of share ownership from LSY to PT Aero Wisata. The proven skills and experience of our people, and complementary international partners, enable Asyst to successfully design, build, deliver and support information systems. We successfully demonstrate our commitment to execute, our desire to be proactive in addressing our clients' needs and how we help enterprises to gain a significant competitive advantage. We are committed to earning the position of trusted adviser, addressing our clients' strategic business issues with Information and Technology services.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11management10soft10services7products6asyst
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessachievedacquisitionactivitiesairlineanterosapolloapplicationappsassistanceasystathenaautomatedauxobestblogsbookbrochurebuiltbusinesscareercargochoiceschronuscitycomingcompanycontactcorporatedesigneddeskdevelopmentdigitaldirectlydoesneasilyensurefleetfulfillmentgivinggoalshavehermeshomehotelimplementincludesindustriesinfrastructureinnovationintegratedknowloyaltymaintenancemanagedmanagementmanagingmannermattermobilemonitoringmultinewsonlineoperationaloptimizeorganizationalperformanceplatformproblemproductproductsprofessionalprojectproviderreadrentalresourceroundscheduleschedulingseriesserveserviceservicesshiftsoftsolutionsolutionssolvespecifiedstaffsystemsteamtimetraveltravelingtripviewworkforce
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Speed optimizations
Score: 22
Failed: 8
Warnings: 1
Passed: 2
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 85% - from 80.4 Kb to 11.75 Kb .
Site Loading Speed Test
  • Your website loading time is around 18.94 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
javascript
34.1 %
1.18 Mb
image
34.0 %
1.17 Mb
css
26.6 %
939.25 Kb
other
3.3 %
115.93 Kb
html
1.8 %
62.21 Kb
font
0.2 %
7.65 Kb
TOTAL
100%
3.45 Mb
Requests by content type
Content type
Percent
Requests
image
36.3 %
29
javascript
32.5 %
26
css
18.8 %
15
other
10.0 %
8
html
1.3 %
1
font
1.3 %
1
TOTAL
100%
80
Content size by domain
Domain
Percent
Size
asyst.co.id
95.2 %
3.28 Mb
connect.facebook.net
3.2 %
113.07 Kb
googletagmanager.com
1.0 %
35.37 Kb
google-analytics.com
0.6 %
19.66 Kb
facebook.com
0.0 %
443 B
stats.g.doubleclick.net
0.0 %
366 B
TOTAL
100%
3.45 Mb
Requests by domain
Domain
Percent
Requests
asyst.co.id
90.0 %
72
connect.facebook.net
2.5 %
2
google-analytics.com
2.5 %
2
facebook.com
2.5 %
2
googletagmanager.com
1.3 %
1
stats.g.doubleclick.net
1.3 %
1
TOTAL
100%
80
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 74
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is not using the HTTP/2 protocol!
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 52
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 mx a:mx2.asyst.co.id a:mx1.asyst.co.id a:mx3.asyst.co.id ip4:103.9.36.45 ip4:103.9.36.142 ip4:103.9.36.44 include:spf.protection.outlook.com include:_spf.google.com -all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved