seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://www.acestarlimos.co.uk
Your general SEO Checkup Score
Archived
72/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 72 out of 100, which is below the average score of 75. However, there are 9 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
9 Failed
0 Warnings
32 Passed
Common SEO issues
Score: 71
Failed: 3
Warnings: 0
Passed: 12
Google Search Results Preview Test
Desktop version
http://www.acestarlimos.co.uk/Acestar Limo Hire Nottingham - Hummer Limousine Hire NottinghamAcestar Limo Hire Nottingham - Specialist chauffeur driven Hummer limousine hire. School Prom Limo Hire, Stag & Hen Limo Hire and Rolls-Royce Wedding Car Hire Nottingham
Mobile version
http://www.acestarlimos.co.uk/Acestar Limo Hire Nottingham - Hummer Limousine Hire NottinghamAcestar Limo Hire Nottingham - Specialist chauffeur driven Hummer limousine hire. School Prom Limo Hire, Stag & Hen Limo Hire and Rolls-Royce Wedding Car Hire Nottingham
Keywords Cloud Test
accompaniedacestarairportareasavailablebasedbentleybestbirthdaybirthdaysbuiltcarschauffeurchauffeurdrivenchauffeurscheckedchesterfieldclasscomfortcompletecontactcorporatecourteouscovercustomcustomerderbydesigneddo'sdriveneasteventeventsexecutivefleethighspechighursthirehomehummerimportantindustryleicesterlimolimoslimousinelimousinesloughboroughluxurymakingmansfieldmercedesbenz'smidlandsnationwidenightnottinghamoccasionoccasionsofferofficepanamerapartypassengersperfectphantompopularporcshepremierprestigepriceprideprofessionalpromproudprovideprovidingquoterawwingreputationrequestrollsroyceserviceservicessheffieldsmartlyspecialsportsstagstarstreetstretchstyletimetransfertransportuniformedunitvehiclesweddingweddings
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage has 22 'img' tags and all of them contain the required 'alt' attribute.
Inline CSS Test
  • Congratulations! Your web page does not use inline CSS styles.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 85
Failed: 2
Warnings: 0
Passed: 9
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 47.13 Kb to 6.81 Kb (86 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 6.252 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 62
  • 2 HTML Pages
  • 17 CSS Files
  • 18 JS Files
  • 25 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your page does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 a mx include:gridhost.co.uk ip4:95.142.156.0/24 ip4:195.62.28.0/23 ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved