seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://wordcounter.net
Your general SEO Checkup Score
Archived
81/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 81 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
1 Warnings
49 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 75
Failed: 4
Warnings: 1
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: WordCounter - Count Words & Correct Writing
Length: 43 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Copy and paste your text into the online editor to count its words and characters, check keyword density, and correct writing mistakes. Bookmark it now, it’s free and easy.
Length: 172 characters
Google Search Results Preview Test
Desktop version
https://wordcounter.net/WordCounter - Count Words & Correct WritingCopy and paste your text into the online editor to count its words and characters, check keyword density, and correct writing mistakes. Bookmark it now, it’s free and easy.
Mobile version
https://wordcounter.net/WordCounter - Count Words & Correct WritingCopy and paste your text into the online editor to count its words and characters, check keyword density, and correct writing mistakes. Bookmark it now, it’s free and easy.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:image
https://wordcounter.net/images/word-counter.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
51words23sentence19save19writing18characters
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
words
sentence
save
writing
characters
Keywords Cloud Test
accountactivitiesactivityautoautomaticallyblogbuttoncasecertainchangescharacterscharscheckcleanclickclosecodecountcreatedeletedensitydetailsdifferentdocumentdownloaddriveeditembedfastfileflowgoalgoalsgrammargrammarlyhandhavehelpimagekeywordkeywordslengthlevellineslistenloginlonglongestmakeminutemultiplenormalnumberoptionspagespanelparagraphspreviewpreviousprintpublisherreadreaderreadingredoremovereplacesavescoreselectsentencesentencesshareshortestsignsiteslowspacesspeakingspeedstepsuresyllablestextthesaurustimetoolsturntypetypingundouniqueuploadusingwantwordwordcounterwordswritewriting
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
0 words 0 characters
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 82
Failed: 4
Warnings: 0
Passed: 16
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 25.21 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,767 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 145.88 Kb to 25.21 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.1 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
50.3 %
580.16 Kb
other
27.8 %
320.13 Kb
html
16.6 %
191.31 Kb
css
3.1 %
35.17 Kb
image
2.3 %
26.01 Kb
font
0.0 %
0 B
TOTAL
100%
1.13 Mb
Requests by content type
Content type
Percent
Requests
other
33.3 %
12
javascript
25.0 %
9
image
19.4 %
7
html
11.1 %
4
css
11.1 %
4
font
0.0 %
0
TOTAL
100%
36
Content size by domain
Domain
Percent
Size
wordcounter.net
38.3 %
441.68 Kb
challenges.cloudflare.com
22.5 %
259.82 Kb
googletagmanager.com
13.1 %
150.72 Kb
platform.twitter.com
11.3 %
130.48 Kb
cdnjs.cloudflare.com
7.8 %
90.01 Kb
connect.facebook.net
6.8 %
78.69 Kb
syndication.twitter.com
0.1 %
902 B
stats.g.doubleclick.net
0.0 %
514 B
TOTAL
100%
1.13 Mb
Requests by domain
Domain
Percent
Requests
wordcounter.net
50.0 %
18
challenges.cloudflare.com
19.4 %
7
cdnjs.cloudflare.com
11.1 %
4
platform.twitter.com
5.6 %
2
connect.facebook.net
5.6 %
2
googletagmanager.com
2.8 %
1
stats.g.doubleclick.net
2.8 %
1
syndication.twitter.com
2.8 %
1
TOTAL
100%
36
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.060 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.06 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.416 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.416 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.42 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.42 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Apart from counting words and characters, our online editor can help you to impr...
Html:

Apart from counting words and characters, our online editor can help you to improve word choice and writing style, and, optionally, help you to detect grammar mistakes and plagiarism. To check word

Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0501. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0501

0.1

0.25

DOM element which contributes the most to CLS score:
Text: What is WordCounter? Apart from counting words and characters, our online edito...
Html: <div class="col-md-12">
Score: 0.0301
Server and security
Score: 89
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "wordcounter.net" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
wordcounter.net
Subject Alternative Names (SANs)
wordcounter.net, *.wordcounter.net
Not valid before
Mon, December 8o 2025, 8:55:39 am (z)
Not valid after
Sun, March 8o 2026, 9:55:35 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Root certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 76
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.google.com include:_spf.getresponse.com include:_spf.hostedemail.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved