seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://weddingcarhire.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 104 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
3 Warnings
57 Passed
Issues to fix
HIGH
Minify all CSS files to ensure faster loading times, improved performance and better caching.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 88
Failed: 2
Warnings: 1
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 16 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Wedding Car Hire
Length: 16 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Find the perfect wedding car for your big day! Choose from a range of cars, including classic cars, luxury chauffeur cars, to the ultimate Rolls Royce Phantom, and more.
Length: 169 characters
Google Search Results Preview Test
Desktop version
https://weddingcarhire.co.uk/Wedding Car HireFind the perfect wedding car for your big day! Choose from a range of cars, including classic cars, luxury chauffeur cars, to the ultimate Rolls Royce Phantom, and more.
Mobile version
https://weddingcarhire.co.uk/Wedding Car HireFind the perfect wedding car for your big day! Choose from a range of cars, including classic cars, luxury chauffeur cars, to the ultimate Rolls Royce Phantom, and more.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Wedding Car Hire
og:image
https://weddingcarhire.co.uk/images/gallery/wedding-cars/rolls-royce-phantom-white/1937.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
52wedding32cars16transport12hire12book
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
wedding
cars
transport
hire
book
Keywords Cloud Test
arriveaskedavailablebentleybestbetterbookbookingbridecancellationcarsceremonychauffeurcheckchoicechooseclassclassiccomecomparecontactcouplescoverdealsearlierenterexperienceexpertsfactfaqsfeelfreegalleryhavehelphirehomehugeincludinginstantinsurancejustlikelikelylimoslivelookingluxurymajoritymakemercedesminimummodernmoneymulsanneofferonlineoptionsperfectphantomplaceplanningpopularpricesquestionsquotequotesrangereceptionrentalrightrollsroverroycesearchsecureselectionservicesportsstartstartedstepstylethemethingstransporttraveltripstypesultimatevehiclesvenueviewvintagevoguewantweddingweddingcarhirewelcomewhilst
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Wedding Car Hire
H2 tags
Compare prices for wedding cars in UK
FAQs about Wedding Transport Rental
Compare Online Prices for Wedding Transport Rental
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 75
Failed: 4
Warnings: 1
Passed: 13
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 11.5 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,532 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 134.76 Kb to 11.5 Kb (91% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.06 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
40.2 %
292.99 Kb
font
23.9 %
174.17 Kb
javascript
23.4 %
170.32 Kb
css
10.9 %
79.65 Kb
html
1.6 %
11.35 Kb
other
0.1 %
466 B
TOTAL
100%
728.94 Kb
Requests by content type
Content type
Percent
Requests
javascript
25.6 %
11
image
25.6 %
11
css
23.3 %
10
font
18.6 %
8
other
4.7 %
2
html
2.3 %
1
TOTAL
100%
43
Content size by domain
Domain
Percent
Size
weddingcarhire.co.uk
81.4 %
593.65 Kb
fonts.gstatic.com
8.9 %
64.90 Kb
googletagmanager.com
6.4 %
46.85 Kb
google-analytics.com
2.8 %
20.71 Kb
fonts.googleapis.com
0.3 %
2.14 Kb
google.com
0.1 %
408 B
stats.g.doubleclick.net
0.0 %
303 B
TOTAL
100%
728.94 Kb
Requests by domain
Domain
Percent
Requests
weddingcarhire.co.uk
67.4 %
29
fonts.gstatic.com
14.0 %
6
fonts.googleapis.com
7.0 %
3
google-analytics.com
4.7 %
2
googletagmanager.com
2.3 %
1
stats.g.doubleclick.net
2.3 %
1
google.com
2.3 %
1
TOTAL
100%
43
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • This webpage is using CSS resources that are not minified!
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 3.76 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.76 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div id="player" class="container-player playing d-xl-block d-none">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.041. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0412

0.1

0.25

DOM element which contributes the most to CLS score:
Text: WHY BOOK WITH WEDDING CAR HIRE LIVE SEARCH Enter your booking requirements and ...
Html: <div class="company-section">
Score: 0.0244
Server and security
Score: 86
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "weddingcarhire.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
weddingcarhire.co.uk
Subject Alternative Names (SANs)
weddingcarhire.co.uk, *.weddingcarhire.co.uk
Not valid before
Mon, June 12o 2023, 1:13:44 am (z)
Not valid after
Sun, September 10o 2023, 1:13:43 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://weddingcarhire.co.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://weddingcarhire.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved