seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://watchhentai.xxx
Your general SEO Checkup Score
Archived
97/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 97 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
0 Warnings
46 Passed
Common SEO issues
Score: 57
Failed: 6
Warnings: 0
Passed: 14
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Watch Hentai Stream - Free Hentai Online!
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: watchhentai.xxx - Thousands of Hentai videos to watch and download for free, watch free hentai streaming online, uncensored hentai tentacle, rape, virgin, school, milf, sister incest, big tits, monster, teen, hentai anime porn
Google Search Results Preview Test
Desktop version
https://watchhentai.xxxWatch Hentai Stream - Free Hentai Online!watchhentai.xxx - Thousands of Hentai videos to watch and download for free, watch free hentai streaming online, uncensored hentai tentacle, rape, virgin, school, milf, sister incest, big tits, monster, teen, hentai anime porn
Mobile version
https://watchhentai.xxxWatch Hentai Stream - Free Hentai Online!watchhentai.xxx - Thousands of Hentai videos to watch and download for free, watch free hentai streaming online, uncensored hentai tentacle, rape, virgin, school, milf, sister incest, big tits, monster, teen, hentai anime porn
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
31episode2animation2yariman2gakuen2enkou
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
abaddonameyadorianimationbrandishchichichijokucolosseumenkouepisodefukaigakuengirlsharemhimeisshojoshikanojokanyuukeikakukendokyoushitsulatestlifemajimemesunariyukinemurunightnikkininshinnuresukenursesonahooppaiorderotomeoujaoujopagepapakatsupersonapheromoneraperatingrebornresultssagasaikyousaretaraseifukuseisoshiftshinshiyostampswamptenseiviewsyagamiyamitsukiyariciryarimanzenin
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 10
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 11.5 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 90.27 Kb to 11.5 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.07 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
58.4 %
451.88 Kb
javascript
16.5 %
127.96 Kb
other
11.9 %
92.35 Kb
css
11.5 %
89.13 Kb
html
1.6 %
12.40 Kb
font
0.0 %
0 B
TOTAL
100%
773.71 Kb
Requests by content type
Content type
Percent
Requests
image
53.7 %
22
javascript
24.4 %
10
css
12.2 %
5
other
7.3 %
3
html
2.4 %
1
font
0.0 %
0
TOTAL
100%
41
Content size by domain
Domain
Percent
Size
watchhentai.xxx
79.5 %
614.84 Kb
cdnjs.cloudflare.com
13.3 %
103.17 Kb
googletagmanager.com
4.6 %
35.76 Kb
google-analytics.com
2.6 %
19.94 Kb
TOTAL
100%
773.71 Kb
Requests by domain
Domain
Percent
Requests
watchhentai.xxx
85.4 %
35
cdnjs.cloudflare.com
7.3 %
3
google-analytics.com
4.9 %
2
googletagmanager.com
2.4 %
1
TOTAL
100%
41
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 43
Failed: 3
Warnings: 0
Passed: 5
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://watchhentai.xxx is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://watchhentai.xxx/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved