seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://voipforum.in
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 11 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
11 Failed
1 Warnings
30 Passed
Common SEO issues
Score: 75
Failed: 2
Warnings: 1
Passed: 12
Google Search Results Preview
Desktop version
http://voipforum.in/VoIP Forum | VoIP Forum Sell Buy Minutes | VoIP Business ForumWelcome to VoIP Forum here you can sell and buy your VoIP Minutes, VoIP software, VoIP hardware and also discuss any topic related to VoIP Business. We do best in VoIP forum sell buy minutes and become best VoIP forum.
Mobile version
http://voipforum.in/VoIP Forum | VoIP Forum Sell Buy Minutes | VoIP Business ForumWelcome to VoIP Forum here you can sell and buy your VoIP Minutes, VoIP software, VoIP hardware and also discuss any topic related to VoIP Business. We do best in VoIP forum sell buy minutes and become best VoIP forum.
Keywords Cloud
alternativeaskedbangladeshbestbusinesscallingcandidatecapacitycardschannelclaireconditionsconfusioncontactcontentdesireddestinationsdialerdifferentdiscussdiscussionseasilyeasytalk.palakemail:voipindia.forums@gmail.comexclusiveexperiencedexpertsforumfreshnessgeneralhardwarehirehomehourhourshurryikconikcondialerindiaindustryinformationinfotechinfotech(makejobsjustlocationloginlookingmembersmenuminutesmobilemonthsneedchadindiauzbekistanegyptwietnammaliphiliindonesianigeriaoffersopeningpersonpeterplanpolicypostpostspoweredprivacyproposalproposalsqualityquestionratesrecentregisterreservedrightsrouteroutesroutes.postsectionsellservicesservices.heresharesoftsoftwaresolutionsuitabletechnicaltermination/voiptermstopictopicstunisiaupdateduptovaluevariousversionviewsvoipwantwholesale
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • We have found 6 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 21 'img' tags and 9 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 14 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
Speed optimizations
Score: 46
Failed: 5
Warnings: 0
Passed: 6
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 78 % - from 47.82 Kb to 10.36 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 3.692 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 69
  • 4 HTML Pages
  • 21 CSS Files
  • 25 JS Files
  • 19 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 66
Failed: 3
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.2.15 (CentOS)
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page is using the canonical link tag. This tag specifies that the URL: http://voipforum.in is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel="canonical" href="http://voipforum.in/" />
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved