seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.usnewsday.net
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 114 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
2 Warnings
36 Passed
Common SEO issues
Score: 71
Failed: 3
Warnings: 1
Passed: 13
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Us News Day
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: usnewsday,news sites,news of the world online,health news,world economic statistics,recent economic news,health information,news
Google Search Results Preview
Desktop version
http://www.usnewsday.netUs News Dayusnewsday,news sites,news of the world online,health news,world economic statistics,recent economic news,health information,news
Mobile version
http://www.usnewsday.netUs News Dayusnewsday,news sites,news of the world online,health news,world economic statistics,recent economic news,health information,news
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19august15news15usnewsday6wake6online
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
abusedachievesadvantagesafricanannihilatingareaarethaastrosaugustbattlebeauticianbestblackcampaigncaracarpetchineseclasscontinuescouplesdeepdelevingnediseasedrinkingemergencyeuropefacefamousfashionfeverfilmfootfuckhandhandlehealthhinchhistorichottesthugeinformationinstructionsjennerkylielatestlifelimemanafortmanicuristmedicalmissionmodelsmouthnewsnews.wondernumberoffersonlineonwardoutbreakpantherpaulpennsylvaniapicturepigspriestsproceedpushingranchersrationalreboundrecollectremindersaysscottsearchsecondseparatedsessionsetssimplestsitesspacesuicidesurvivorswinetransplanttravistrumpunitupsetusnewsdayversuswakewaterwe’llwilderwinningworldwrath
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Us News Day
H2 tags
Health
Us Army
A Reminder That Cara Delevingne continues to be one in every of the simplest Fashion Models: usnewsday
online news.Wonder says fuck your “famous film” class, is as yet pushing Black Panther for Best Picture
news sites : African swine fever achieves Europe in the wake of annihilating Chinese ranchers with a huge number of pigs to be separated
Instructions to HANDLE A MEDICAL EMERGENCY ON A DEEP SPACE MISSION
paul manafort trump campaign
Kylie Jenner, Travis Scott and More Of The Hottest Couples On The Carpet- 2018
Beautician, manicurist recollect rational Aretha
usnewsday Hand, Foot And Mouth Disease Outbreak
Posts navigation
Sport
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 83
Failed: 2
Warnings: 1
Passed: 5
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 12.41 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 70.71 Kb to 12.41 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 7.46 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 50
  • 7 HTML Pages
  • 4 CSS Files
  • 20 JS Files
  • 19 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your website's CSS files are minified!
See results list
URL Redirects Checker
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 73
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 70
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.usnewsday.net/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.usnewsday.net/" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 a mx include:websitewelcome.com ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved