seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://us.refurb.io
Your general SEO Checkup Score
Archived
98/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 98 out of 100, which is higher than the average score of 75. Our analysis has identified 12 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
0 Warnings
46 Passed
Common SEO issues
Score: 74
Failed: 4
Warnings: 0
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Refurbished Laptops & Desktops from Dell, HP, Lenovo and more — REFURB.io USA
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: We are a Microsoft Authorized Refurbisher selling quality refurbs from recognizable and trusted brands such as Dell, HP, Lenovo. We carry laptops, desktops, monitors, accessories and more. We are highly reviewed and provide warranty for all systems and laptops. Shop with us today!
Google Search Results Preview Test
Desktop version
https://us.refurb.ioRefurbished Laptops & Desktops from Dell, HP, Lenovo and more — REFURB.io USAWe are a Microsoft Authorized Refurbisher selling quality refurbs from recognizable and trusted brands such as Dell, HP, Lenovo. We carry laptops, desktops, monitors, accessories and more. We are highly reviewed and provide warranty for all systems and laptops. Shop with us today!
Mobile version
https://us.refurb.ioRefurbished Laptops & Desktops from Dell, HP, Lenovo and more — REFURB.io USAWe are a Microsoft Authorized Refurbisher selling quality refurbs from recognizable and trusted brands such as Dell, HP, Lenovo. We carry laptops, desktops, monitors, accessories and more. We are highly reviewed and provide warranty for all systems and laptops. Shop with us today!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
259price172original103dell101save85drive
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessoriesaceraiosboughtbrandbrandscamecartcategorieschromebookscomboscomescomputerconditioncorecurrentdealsdelldesigndesktopdesktopsdetailsdiskdrivedriveseasyelitedeskfactorfastfeaturesformgenerationgoinggoodgreathardhaveheavenhelphomeinstalledintelitemjustlaptoplaptopslatitudelenovolikememorymicrominimodelmonitormonitorsmultipleoperatingoptiplexorderoriginalpackagingpartsplayedprecisionpriceproblemsprocessorproductprogrampurchasepurchasesratingreadrefurbrefurbishedrefurbisherrequestreviewreviewssamsungsaveserviceshopsleekslidesmallsolidspacespeedstarstatestocksupporttowerviewwebcamwindwindowsworksxeon
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Black Friday Deals for You
Windows 11 Ready Deals!
Intel Core i7 Deals!
HP Desktop Deals!
DELL Desktop Deals!
Intel Core i5 Deals!
HOLIDAY DEALS ON WINDOWS 11 READY
Dell OptiPlex 3060 SFF Desktop Intel Core i5-8400 2.8GHz 8GB RAM 512GB Solid State Drive, Windows10 Pro - Refurbished
Dell OptiPlex 5070 Mini Desktop - Intel Core i5-9500T 2.2Ghz 16GB RAM 256GB Solid State Drive, Windows 10 Pro - Refurbished
HP EliteDesk 800 G4 Mini Desktop Intel Core i7-8700 3.2GHz ,16GB RAM 256GB Solid State Drive Windows 10 Pro-Refurbished
Dell OptiPlex 7060 Mini Desktop - Intel Core i7-8700T 2.4GHz, 32GB RAM, 1TGB Solid State Drive, Windows 10 Pro - Refurbished
Dell OptiPlex 3060 Mini Desktop Intel Core i5-8400T 1.7GHz 16GB RAM 512GB Solid State Drive, Windows 10 Pro - Refurbished
Dell OptiPlex 3060 Micro Desktop Intel Core i5-8400T 1.7GHz 8GB RAM 256GB Solid State Drive, Windows 10 Pro - Refurbished
HOLIDAY DEALS ON LAPTOPS
Dell Precision M7730 17.3" Intel XEON E-2176M 2.7GHz 64GB RAM, 1TB Solid State Drive, Windows 10 Pro - Refurbished
Dell Latitude 7420 2-in-1 14" Intel Core i7-1185 G7 3.0GHz 16GB RAM, 512GB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7720 17.3" Intel Core i7-7820HQ 2.9GHz 64GB RAM, 512GB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7540 15.6" Intel Xeon E-2276M 2.8GHz 64GB RAM, 1TB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7530 15.6" Intel Xeon E-2176M 2.7GHz 64GB RAM, 1TB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7720 17.3" Intel Core i7-7820HQ 2.9GHz 32GB RAM, 1TB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7530 15.6" Intel Core i7-8750H 2.2GHz 32GB RAM, 512GB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7530 15.6" Intel Core i7-8850H 2.6GHz 16GB RAM, 256GB Solid State Drive, Windows 10 Pro - Refurbished
Dell Precision M7720 17.3" Intel Core i7-7820HQ 2.9GHz 32GB RAM, 512GB Solid State Drive, Windows 10 Pro - Refurbished
DELL XPS 9380 13" Intel Core i7-8565U 1.80 GHz 16GB RAM 512GB SSD, Webcam, Windows 10 Pro - Refurbished
HOLIDAY DEALS ON DESKTOPS
Dell Precision 5810 Tower Workstation Intel Xeon E5650 3.5GHz 16 GB RAM, 500GB Hard Disk Drive NVIDIA Quadro M2000 - Refurbished
HP EliteDesk 800 G3 SFF Intel Core i7-6700 3.4GHz ,32GB RAM 512GB Solid State Drive, DVD-RW, Windows 10 Pro-Refurbished
HP EliteDesk 800 G2 SFF Desktop Intel Core i7-6700 3.4GHz ,32GB RAM 1TB Solid State Drive Windows 10 Pro-Refurbished
HP EliteDesk 800 G2 SFF Desktop - Intel Core i7-6700 3.4GHz, 32GB RAM, 1TB Solid State Drive, Windows 10 Pro - Refurbished
Deal of The Day
HP ProBook x360 310 G1 11.6" Touch EE Notebook Intel Pentium-N4200 1.10GHz 8GB RAM, 128GB Solid State Drive, Webcam, Windows 10 Pro - Refurbished
Trending Deals
Acer P446 TravelMate 14" Notebook - i5 5200U 2.2 GHz, 8GB RAM, 256GB Solid State Drive, Windows 10 Pro, Webcam - Refurbished
Dell Latitude E7250 12.5" Laptop Intel Core i7-5600U 2.6GHz 8GB RAM 240GB SSD Windows 10 Pro - Refurbished
Dell Optiplex 3020 Tower Intel Core i7-4770 3.4GHz ,16GB RAM 512GB Solid State Drive Windows 10 Pro-Refurbished
Samsung 303 11" ChromeBook Exynos 1.7GHz, 2GB RAM 16GB Solid State Drive Chrome OS - B-Grade - Refurbished
HP Prodesk 400 G1 SFF Desktop - Intel Core i7-4770 3.4GHz, 16GB RAM, 240GB Solid State Drive, DVD, Windows 10 Pro - Refurbished
HP Elite 8300 USFF Desktop - Intel Core i5-3470S 2.9GHz, 8GB RAM, 128GB Solid State Drive, Windows 10 Pro - Refurbished
Dell Optiplex 390 SFF Desktop Intel Core i3-2100 3.1GHz ,8GB RAM 1TB Hard Disk Drive Windows 10 Pro-Refurbished
Dell OptiPlex 7020 SFF Desktop - Intel Core i5-4570 3.2GHz, 32GB RAM, 512GB Solid State Drive, DVD, Windows 10 Pro - Refurbished
Dell Optiplex 7020 Tower Desktop - Intel Core i5-4570 3.2GHz, 16GB RAM, 512GB Solid State Drive, DVD, Windows 10 Pro - Refurbished
3.5" 2TB SATA II Hard Drive 7200RPM
HP 840 G2 EliteBook 14" Intel i5-5200U 2.2GHz 8GB RAM, 256GB Solid State Drive, Windows 10 Pro - Refurbished
HP 640 G2 ProBook 14” Intel i5-6200U 2.3GHz 8GB RAM, 256GB Solid State Drive, Webcam Windows 10 Pro - Refurbished
HP EliteDesk 800 G1 SFF Desktop - Intel Core i5-4590 3.3GHz, 16GB RAM, 1TB + 256GB Solid State Drive, DVD, Windows 10 Pro - Refurbished
Dell OptiPlex 7010 SFF Desktop Intel Core i7-3770 3.4GHz, 16GB RAM, 1TB Solid State Drive, DVD, Windows 10 Pro - Refurbished
Dell OptiPlex 3040 SFF Desktop - Intel Core i5-6400 2.2GHz, 8GB RAM, 240GB Solid State Drive, Windows 10 Pro - Refurbished + Office Home & Student 2019
Dell 3040 SFF Desktop Intel Core i5-6500 3.2GHz 16GB RAM 256GB Solid State Drive Windows 10 Pro - Refurbished
2.5" 240GB SSD SATA II Hard Drive 400/300 MB/s Read/Write
2.5" 160GB SATA II Hard Drive
Shop By Product
Laptops
Desktops
All-in-One
New Arrivals
LENOVO M810Z All-In-One 21.5'' Desktop Intel Core i5-6400T 2.20GHz, 8GB RAM, 256GB Solid State Drive, Windows 10 Pro - Refurbished
LENOVO M810Z All-In-One 21.5'' Desktop Intel Core i5-6400T 2.20GHz, 16GB RAM, 256GB Solid State Drive, Windows 10 Pro - Refurbished
Dell OptiPlex 7020 SFF, Intel Core i7-4770, 16GB RAM, 512GB Solid State Drive, Dual Monitor Combo, 2 x 20" LCD, Windows 10 Pro - Refurbished
Dell 5260 All-in-One 21'' Desktop Intel Core i5-8400 3.2GHz, 16GB RAM 500GB Hard Disk Drive, Windows 10 Pro - Refurbished
Microsoft Authorized Refurbisher
Accessories & Parts
Trending Products
Shop By Categories
Best Selling Products
Shop By Brands
Product Reviews
Blog posts
SSD vs HDD: Which one should I buy?
Tips on Buying Refurbished Computers
How to clean your Computer?
Get exclusive updates on new products
Follow us
Customer Support
My Account
Hours of Operation
Subscribe
Added to your cart:
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Speed optimizations
Score: 70
Failed: 4
Warnings: 0
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 1063.42 Kb to 132.29 Kb (88% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 5.58 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
javascript
64.1 %
2.16 Mb
image
25.0 %
860.85 Kb
css
3.8 %
129.39 Kb
font
3.2 %
109.87 Kb
html
2.6 %
90.06 Kb
other
1.3 %
45.63 Kb
TOTAL
100%
3.36 Mb
Requests by content type
Content type
Percent
Requests
javascript
37.0 %
74
other
28.5 %
57
image
22.5 %
45
css
6.0 %
12
font
4.0 %
8
html
2.0 %
4
TOTAL
100%
200
Content size by domain
Domain
Percent
Size
cdn.shopify.com
23.6 %
811.87 Kb
d3k81ch9hvuctc.cloudfront.net
16.9 %
581.70 Kb
js.smile.io
8.3 %
284.87 Kb
sdk.postscript.io
7.6 %
260.19 Kb
amaicdn.com
6.2 %
213.03 Kb
staticw2.yotpo.com
6.0 %
207.95 Kb
googletagmanager.com
4.8 %
165.79 Kb
static.klaviyo.com
4.7 %
161.91 Kb
connect.facebook.net
3.3 %
113.65 Kb
sdk.qikify.com
3.1 %
105.77 Kb
Other
15.6 %
537.82 Kb
TOTAL
100%
3.36 Mb
Requests by domain
Domain
Percent
Requests
cdn.shopify.com
19.0 %
38
staticw2.yotpo.com
17.0 %
34
static.klaviyo.com
7.0 %
14
godog.shopifycloud.com
4.0 %
8
js.smile.io
4.0 %
8
monorail-edge.shopifysvc.com
3.0 %
6
img.riskified.com
2.5 %
5
us.refurb.io
2.0 %
4
fonts.shopifycdn.com
2.0 %
4
amaicdn.com
2.0 %
4
Other
37.5 %
75
TOTAL
100%
200
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 74
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
SSL Checker and HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 0
Passed: 7
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://us.refurb.io is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://us.refurb.io/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved