seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://thebasshop.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 111 out of 100, which is higher than the average score of 75. Our analysis has identified 7 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
7 Failed
1 Warnings
43 Passed
Common SEO issues
Score: 86
Failed: 1
Warnings: 1
Passed: 15
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: The Bas Shop - Star Wars Clothing Accessories Shirts & All at Sale
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: The best place online where to find the coolest stuff of the year, at the cheapest price! Whether you're original Star Wars trilogy type old-school or a relative newcomer to our galaxy far, far away, we have enough Star Wars apparel & clothing accessories.
Google Search Results Preview Test
Desktop version
https://thebasshop.co.ukThe Bas Shop - Star Wars Clothing Accessories Shirts & All at SaleThe best place online where to find the coolest stuff of the year, at the cheapest price! Whether you're original Star Wars trilogy type old-school or a relative newcomer to our galaxy far, far away, we have enough Star Wars apparel & clothing accessories.
Mobile version
https://thebasshop.co.ukThe Bas Shop - Star Wars Clothing Accessories Shirts & All at SaleThe best place online where to find the coolest stuff of the year, at the cheapest price! Whether you're original Star Wars trilogy type old-school or a relative newcomer to our galaxy far, far away, we have enough Star Wars apparel & clothing accessories.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
104type49cart44sale30shirt23years
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessoriesactionbackpacksballbaseballbeautyblockbrandbroadclothsalecanvascartcasualcasualmaterialcheckoutchildrencollectionconsolescontrolcottoncottoncollarcoverdarthdaysdeloreandustinfantasyfashionfeaturesfigurefiguresfinalfinishedfreefuturegamehoodiesinspireditemkeepinglegoinglylengthletterlitrerainlocksmartymaterialmcflymenitemmerchmodelnecksleevenocarryingnofabricnumberorderspackpluspolyestercapacityprintedprinthoodedproductsrangeregularpatternretrosaleschoolseriesshippingshirtshirtsshopshortshortstylesignaturesimplicitysizesleevesoftbackclosuresoldierstarstormtrooperstraightstrangerstrapstylesummerteesteesgenderthingstimetopstopstoystuckedtypevaderviewwarsweekyearszipperlining
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
title
STRANGER THINGS
Stranger Things Dustin Cap Hat Summer
Stranger Things Baseball Cap Snapback
stranger things - T-Shirt
Stranger Things Dustin Caps
Stranger Things - Dustin baseball Cap Hat
BACK TO THE FUTURE II MEMORABILIA
Back To The Future 2 - Air Mag Shoes
mens t shirts fashion 2018 Back To The Future Marty Mcfly Emmett Brown High Quality Cotton O-Neck Short Sleeve TShirts Male Tees
Back to the Future Doc Brown Marty McFly Official Tee T-Shirt Mens New 2019 Hot Summer Casual T-Shirt Printing
Back To The Future Letter 3D Printed Canvas Backpacks For Boys Girls School Bags Children Bookbag Casual Daypack Mochila Escolar
Back To The Future Letter 3D Printing Backpacks For Boy Girls School Bag Teenage Children Bookbag Casual Daypack Mochila Escolar
Back To The Future Letter 3D Printing Canvas Backpacks Pencil Bag 3Pcs/Set Portfolio For Boy Girls School Bag Bookbag Mochila
New Fashion Back To The Future Luminous Backpack Women Men Laptop Backpack School Bags for Teenagers Student Large Travel Bags
The Doctor's Train Paper Model In The Movie "back To The Future" Papercraft Handmade Toy
Back To The Future Printed Backpacks High School Boys Girls Book Bag Daily Laptop Backpack Women Men Canvas School Travel Bags
delorean motor company Baseball Cap Back To The Future Film caps Snapback hat For Men Mesh Net Trucker Cap Dad Hat
Welly 1:24 DMC-12 Delorean Fly Mode Time Machine Back To The Future 2 Diecast Model Car
Original Funko pop Secondhand Movies: Back to The Future - Dr. Emmett Brown Vinyl Action Figure Collectible Model Loose Toy
Takara Tomy Tomica Dream 146 DELOREAN PART3 Back to the future Diecast Motors vehicle Diecast metal model Collection gift toys
1/24 Scale Metal Alloy Car Diecast Model Part 1 2 3 Time Machine DeLorean DMC-12 Model Toy Back to the Future Fly version Part 2
Takerlama Fashion Marty McFly Licensed for Rainbow Color Changing Hat Cap Back to the Future Prop Bigbang G-Dragon Baseball Cap
Back To The Future Car Paper Model
STAR WARS MEMORABILIA
Banksy Star Wars Pulp Fiction Hip Hop Hooded Men 2019 autumn winter new warm fleece men sweatshirts hoodies men tracksuit S-2XL
New Arrival Banksy Star Wars Pulp Fiction Hip Hop Men T Shirt 2018 Summer Harajuku Men T Shirts 100% Cotton Short Sleeve T-Shirt
star wars t shirt Men funny darth vader T-Shirt starwars porg stormtrooper bb8 top Tee Clothes star-wars tshirt
NEW 2018 funny Printed Star Wars T-Shirt robot shirt star wars the last jedi Men's sleeve T shirt Tops Fashion Tees Darth Vader
hot Summer Fashion star wars king T Shirt Men's High Quality Tops Tees Custom male t-shirt Printed clothing
2017 Men t shirt fashion Cool Star Wars Empire Sketch robot White hip pop funny Short sleeve t-shirt summer tee shirt homme
Star Wars Yoda T Shirt Men's XL-5XL Short Sleeve Big Size Round Neck Group Tee Shirts 100% Cotton Tshirt
Never Received My Hogwarts Letter Fandom Jedi T Shirts Star Wars 100% Cotton Tees Printed T-Shirts Men Short Sleeve
Marvel Star Wars Yoda Darth Vader Stormtrooper Action Figure Toys The Force Awakens Jedi Master Yoda Anime Figures Lightsaber
Hot STAR WARS Action Figure Darth Vader Stormtrooper Anime Home Car Room Decor Kids Birthday Christmas toys for children Figures
Star Wars Printed Mens Men T Shirt Camisetas Masculinas 2019 Manga Curta Camisa Masculina Tshirt Size XS-2XL
Darth Vader Star Wars Jedi Selfie Stormtrooper Funny Men T shirt Birthday Gift Free shipping Harajuku Tops Fashion Classic
Star Wars Order Poe's X Toys wing Fighter Building Block Bricks 79209 75102 Educational Gift Compatible With LegoINGLY StarWars
Bela 10900 Star Wars Series Imperial TIE Fighter Building Block 550pcs Bricks Toys Compatible With Legoings 75122
1381Pcs Millennium Falcon Force Awakening Star Wars 7 Building Blocks Toys For Children Star Wars Toys With legoingly 79211
Fast Shipping BB-8 Ball Star Wars RC Action Figure BB 8 Droid Robot 2.4G Remote Control Intelligent Robot BB8 Model Kid Toy Gift
FINAL FANTASY
Final Fantasy T shirt Final Fantasy 15 Noctis Lucis Caelum T-shirt FFXV Summer Short Sleeve Tee Shirt For Men Women
Final Fantasy Action Figure Play Arts Kai Cloud Strife Collection Model Toy PLAY ARTS Final Fantasy Cloud Strife Playarts PA34
Final Fantasy XV - T-shirt
Final Fantasy VII - 5pcs/set Cloud Warrior of Light Action Figures
Final Fantasy T Shirt Men Game T-Shirt
Breaking Bad Merch
The Walking Dead Merch
Stranger Things Merch
Back To the Future Merch
the Goonies Merch
Pulp Fiction Merch
Kill Bill Merch
Beetlejuice Merch
Narcos Merch
t
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 77
Failed: 3
Warnings: 0
Passed: 8
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 280.01 Kb to 38.8 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 5.38 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 149
  • 6 HTML Pages
  • 11 CSS Files
  • 55 JS Files
  • 77 Images
  • 0 Flash Files
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 89
Failed: 1
Warnings: 0
Passed: 6
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://thebasshop.co.uk is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://thebasshop.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved