seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://telectronics.pk
Your general SEO Checkup Score
Archived
79/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 79 out of 100, which is higher than the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
2 Warnings
45 Passed
Common SEO issues
Score: 60
Failed: 6
Warnings: 2
Passed: 14
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Online Shopping in Pakistan | Mobile Accessories | Mi, QCY, Baseus, Remax Telectronics.pk
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Buy 100% Genuine Products from Telectronics.pk the best online online shopping site in Pakistan. Get you favorite products from telectronics.pk online shopping store or from retail outlet in Lahore. Best prices Original and quality products. Mobile accessories, headphones, Speakers, powerbanks, earphones. Brands Baseus, Xiaomi, Aukey, Ravpower, Remax. Free Cash on delivery on all over Pakistan.
Google Search Results Preview Test
Desktop version
https://telectronics.pkOnline Shopping in Pakistan | Mobile Accessories | Mi, QCY, Baseus, Remax Telectronics.pkBuy 100% Genuine Products from Telectronics.pk the best online online shopping site in Pakistan. Get you favorite products from telectronics.pk online shopping store or from retail outlet in Lahore. Best prices Original and quality products. Mobile accessories, headphones, Speakers, powerbanks, earphones. Brands Baseus, Xiaomi, Aukey, Ravpower, Remax. Free Cash on delivery on all over Pakistan.
Mobile version
https://telectronics.pkOnline Shopping in Pakistan | Mobile Accessories | Mi, QCY, Baseus, Remax Telectronics.pkBuy 100% Genuine Products from Telectronics.pk the best online online shopping site in Pakistan. Get you favorite products from telectronics.pk online shopping store or from retail outlet in Lahore. Best prices Original and quality products. Mobile accessories, headphones, Speakers, powerbanks, earphones. Brands Baseus, Xiaomi, Aukey, Ravpower, Remax. Free Cash on delivery on all over Pakistan.
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessoriesandroidankerappleaudiobankbaseusbestblackbluediobluetoothbrandscablecablescahubcamerascartchargerchargerschargingcontactdisplaydockingdualearbudsearphonefastflashgadgetsgaminggleamgrayhavehaylouhdmiheadphonesheadsetheadsetsholderhomeinchiphonejustlaptoplatestlenovomacbookmagneticmetalmicromicrophonemicrophonesminimobilemousemultifunctionalofficeonlineopenoriginalpakistanphoneplusportportablepowerpowerbankspriceproductsprojectorsqualityquickregularremaxreviewromosssalesamsungscreenseriesshopshoppingsmartsmartwatchspecialsportsstandstationstockstoresuperiortelectronicstruetypeviewwatchwatcheswifiwirelessxiaomi
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Telectronics
List Of Catagories We are dealing In:
H2 tags
Romoss Sense 8P Plus 30000mAh 18W Fast Charge Type-C PD, 3 Outputs & 3 Inputs
Baseus 3 in1 USB To Type C 100W Charging Cable With Apple – Micro – Type C – Charge Data
Baseus Compact Super Quick Charger Dual Port U+C 20W CN
Baseus Flash Series 2-In-1 Fast Charging Type-C To Lightning+Type-C 100W Cable
Baseus Flexible Lazy Neck Phone Holder Stand
Baseus Golden Contactor Pro 40W Quick Dual Port Charger
Baseus H19 Wired Earphones 6D Stereo Bass Headphones
Baseus Share Together Fast Car Charger With Cigarette Lighter Expansion USB + Type C Port 120W
Baseus Simple Wireless Charging Pad 15W
BASEUS Super Si 30W PD Mini Quick Wall Charger Travel Charger Type-C Port [US Plug]
Baseus Superior Series 100 W Fast Charging Type C To Type C Data Cable 1m – Black
Baseus Superior Series 100 W Fast Charging Type C To Type C Data Cable 2m – Black
Baseus Superior Series IPhone Fast Charging Cable 2.4A 1M
Baseus Superior Series IPhone Fast Charging Cable 2.4A 2M
Baseus Superior Series Micro Fast Charging Cable
Baseus Superior Type-C To Iphone 20W Fast Charging Cable 2 Meter
Baseus Superior USB To Type-C 66w Fast Charging Cable 6A 1 Meter
BASEUS SUPERME DIGITAL DISPLAY PPS DUAL QUICK CAR CHARGER – 100W
Baseus Swan 2-In-1 Wireless Magnetic Charging Bracket 20W ( Suit For IP12)
Baseus CAHUB-L0G Thunderbolt C+Pro Seven-In-One Smart HUB Docking Station Grey
Baseus Type-C To Type-C 100W Display Fast Charging Data Cable -1m
Baseus Type-C To Type-C 100W Display Fast Charging Data Cable -2m
Baseus TZWXJK-A01 Simple 2 In 1 24W Turbo Edition Qi Standard Wireless Charger With 12V Charger, CN Plug
Baseus Zinc Magnetic Series 100W Type-C To DC Square Port Cable For Lenovo Laptop
Baseus CRNBQ-01 Car Power Inverter 150W Cigarettes Lighter Input Inverter
Xiaomi Redmi Buds 3 Pro Mi True Wireless Bluetooth Earphone Adaptive Noise Cancelling Earbuds Wireless Charging
Lenovo HQ08 TWS Gaming headset AAC HIFI Music Bluetooth Headphones Waterproof Sports Wireless Earphone with Mic
Infinix iRocker XE15 TWS Wireless Earphone Bluetooth Headset
Baseus Magnetic Wireless Charger Power Bank 10000mAh PD 20W External Battery Portable Powerbank
Baseus 360 Rotation Photo Gimbal Tripod Portable Phone Holder
Baseus Enjoyment MacBook / Notebook Stand HUB USB Typ C PD / VGA / HDMI / RJ45 / USB 3.0 / SD, TF, Micro SD Card Reader Dark For MacBook / PC Gray
Baseus Metal Gleam Series 4-In-1 Multifunctional Type-C HUB Docking Station Gray CAHUB-CW0G
Baseus Metal Gleam Series 6-In-1 Multifunctional Type-C HUB Docking Station Gray CAHUB-CW0G
Baseus Metal Gleam Series 5-In-1 Multifunctional USB-C To 3x USB 3.0 + HDMI + USB-C Hub
Baseus Metal Gleam Series 8 in1 USB-C To 3x USB 3.0 + HDMI + USB-C PD + Ethernet RJ45 + MicroSD/SD Hub
Baseus Letā€S Go Mesh Portable Laptop Stand (SUDD-2G)
Baseus Foldable Laptop stand For Macbook Air Pro Adjustable Aluminum Lap riser Portable Notebook Stand Ultra Thin Book Stand
Baseus CAYPH-F0G Full Speed Series SSD Enclosure(Type-C GEN2) Space Gray
Baseus i-work series USB stepless dimming screen hanging light black (DGIWK-01)
Baseus i-wok Stepless Dimmable Desk Lamp Table Reading light Eye Protection LED Desk Lamp USB Rechargeable Work Study Table Lamp
Baseus CAHUB-AY01 4 in 1 Square Round USB HUB Adapter (USB3.0 TO USB3.0*1+USB2.0*3) 1m- BLACK
LDNIO A8101 QC3.0 50W 8 Ports Desktop Charger
LDNIO A6704 Qualcomm 3.0 Quick Charge 6 USB Ports With Auto ID Desktop Charger
LDNIO SC4407 Power Strip With 4 Socket Outlets and 4 USB Port + Overload Protection QC 3.0 - White
LDNIO SC3604 10A Power Strip 6 USB 3 Universal Socket With Overload Protector Circuit Breaker Switch Outlet Extend
KingSpec 2.5" 128GB/256GB/512GB SATAIII SSD Solid State Drive HDD Hard Drive SATA3 For Laptop PC Desktops Tablet
Tenda F6 Wireless Router AC1200 Router WIFI Repeater With 4 High Gain Antennas Wider Coverage Easy Set Up
Tenda F3 300Mbps 2.4G Wireless WiFi Router Wi-Fi Repeater, English Interface 1WAN+3LAN Ports
Tenda N301 Wireless Router Wifi Router 300Mbps 802.11 b/g/n/3/3u Access Point Signal Booster 4 Ports
Baseus Horizontal HDMI 2.0 Cable 4K 60 Hz 3D 18 Gbps 2M/5M Black (CADSP-D01)
Baseus GMGK01-01 Gamo One-Handed Gaming Keyboard Black
A4Tech Webcam PK-910p/PK910h 720p/1080P HD with Mic - ON HAND
WIWU Lightning HDTV Adapter Cable Phone To TV BLACK
IWO HX68 Plus Smart Watch 1.75"HD Bluetooth Calls Custom Wallpaper Sport Smartwatch
HW56 Plus Smart Watch Wireless Charging Series 7
Mibro Lite Smart watch
Haylou RS3 LS04 Smart Watch 1.2-Inch AMOLED Display
AW12 Steel Strap BT Call Smart Watch Men's Rolex Style Business Sports Smart Watch
IWO N76 Smart Watch Series 7 44mm 1.75" Heart Rate Monitor N76 Smartwatch for Men Women
NO.01 Pro watch 7 Smart Watch Support wireless charging
M99 Smart watch Series 6 Smart watch With Apple Logo ON/OFF
Wi Watch 6 T500 Plus Pro Smart watch Series 6 for Android & IOS Hi Watch
Xiaomi Imilab W11 Ladies Smart Watch
JOYROOM JR-FT1 Pro 1.69 inch Full Touch Screen IP67 Waterproof Smart Watch
Lenovo S2 Pro Smartwatch 1.69'' HD Screen
HT22 Smart watch Series 6
HT66 Smartwatch series 6
IWO HX68 Smart Watch 1.72"HD Bluetooth Calls Custom Wallpaper Sport Smartwatch
HW22 Pro Smart Watch Men 44mm Wireless Charging Bluetooth Call Body Temperature Siri ECG Monitor IP67 Smart watch
W26+ PLUS Smart Watch 44mm Scroll Button Control Series 6 with Multi-color Metal Strap
Xiaomi Imilab W12 Smart watch Business Smartwatch
Soundpeats Watch Pro 1 Smart watch Sports, Health and Fitness Watch
M26 Plus Smart Watch 1.77 Inch Screen Wireless Charging BT Call Series 6 Smartwatch
HW33 smart watch series 6 smartwatches 44mm 1.75 Inch Full Screen Bluetooth Call
IWO HW22 Plus Smart Watch
Haylou RT LS05S Smart watch Global Version
Mibro Color Global Version Smart watch 1.57Inch
L13 Smart Watches Digital Intelligent 1.3inch HD Bluetooth Call
F10 smart watch fitness watch IP67 Waterproof
HT99 Smartwatch Series 6 1:1 Smartwatch
W22+ Series 6 Bluetooth Call Fitness Tracker Waterproof Smartwatch
T500+plus Smart Watch 1.75 inch full screen Series 6 Full Display
W3 Bluetooth Call Smart Watch
Samsung Galaxy Fit 2 Band
Huawei Band 4
DT100 Smart Watch Bluetooth Call 1.75 Inch HD Full Screen
M16 Plus Smart watch 44mm Series 6 BT call smartwatch
HW23 Pro Smart Watch1.78 inch custom dial Bluetooth call 44mm
Baseus CATPQ-A01 Meteorite Shimmer Wireless Display Adapter
Xiaomi Mi TV Stick Smart TV 2K HDR Quad Core DDR4 HDMI 1GB 8GB bluetooth 5G Wifi Android Display Dongle Netflix Google Assistant
2020 X96Q TV Box Android 10.0 2GB 16GB Quad Core 4K 2.4G Wifi Android 10.0 Set Top Box Media Player
Ugreen 40412 Hdmi Cable HD118 Male To Male Cable Version 2.0
G10 Remote Control 2.4GHz Wireless Air Mouse G10s Voice Microphone Gyroscope IR Learning for Android tv box
Amazon Alexa Voice Remote (2nd Gen) with Power and Volume Controls - Requires Compatible Fire TV Device
MXQ Android Smart TV Box - 4K Quad Core - 1G+8G
Android TV Box T9 Android 10 TV Box 4GB DDR3 RAM 64GB ROM RK3318 Bluetooth 4.2 Support 2.4G&5.0GHz WiFi 4K Set Top Box Smart TV
Xiaomi Mi Box 4K HDR Android 9.0 TV Streaming Media Player and Google Assistant Remote Smart TV Mi Box S
Baseus Type-C to HDMI And Type-C Little Box Smart HUB Converter
Baseus Type-C Video Functional Notebook Cable C to C - C 10T
Anycast WiFi Cable
AnyCast M9 Plus 1080P Wireless RK3036 WiFi Display Dongle HDMI Receiver
M4 Plus Wireless WiFi Display Dongle Receiver 1080P HDMI
H96 Pro H3 2GB\16GB HD Android Smart 7.1.2 TV Box
Android Smart TV Box V88 Piano Quad Core 4GB+16GB
Android Smart TV Box X96 Mini Quad Core 2g+16g Android 7.1.2 & 9.0
Sony Hdmi Cable High Speed 5m
Sony Hdmi Cable High Speed 2m
Sony Hdmi Cable High Speed 3m
WE CAST E8 HDMI WiFi DONGLE 1080P
Virtual Reality VR Box 3D Glasses With Remote Control - Black White
Hdmi Flat Cable Ult Unite 2.0v 2k.4k 20m
Hdmi Flat Cable Ult Unit 1.4v 3m 2k.4k Red
Original MI Mijia WPC01ZM 10W MAX Quick Charger Qi Wireless Charger Type-C
Baseus 20000mAh Dual USB Type-C + PD Flash Quick Charging 3.0 18W Power Bank
Baseus Wireless Charger Swan Magnetic Desktop Bracket For Iphone 12 Black/White
IWO W16 IP68 Smart Watch IWO 12 pro Heart Rate Monitor 320*385 Resolution Fashion IWO 12 SmartWatch 6 for Android IOS Phone
Haylou LS01 Smart watches Men outdoor sports watch Heart Rate Tracker Call/Message Reminder Sports Running Music Watch
Wiwu ST02 Pro Gemini Dual Lightning Adapter Converter For IPhone
Baseus 3-Axis Handheld Gimbal Stabilizer Bluetooth Selfie Stick Camera Video Stabilizer Holder For IPhone Samsung Action Camera
Lenovo H402 Gaming Headset Wired Earphones Surround Sound RGB Colourful Light Deep bass in-ear with Mic
Rock Hf-Q6s Bluetooth Wireless Speaker
Original Anker A2054J11 Power Port Speed 5 Qualcomm Dual QC 3.0 USB Quick Charger With Power IQ 63W
Sports Level active EO-EG930 sweatproof In ear earphone bluetooth v4.2 With TF Card Slot Option
Remax RC-044a Platinum Series Data Cable For Type-C - Black
BLUEDIO H+ Turbine Hurrican Wireless Bluetooth 4.1 Headphones - White
REMAX RPP-151 Powerbank 10000mAh Platinum Core QC3.0 + PD Fast Charging
Baseus WIAPPOD-01 Wireless Charger For Airpods 1 -BLACK
IWO 8 Pro T5 2020 Smart Watch Series 5 Heart rate Blood pressure Sports Watch For IOS Android for Men and Women
Baseus W07 TWS Bluetooth Earphone Stereo True Wireless Earbuds Sports Noise Reduction Headset Bluetooth 5.0 Headphones with Mic
W26+ PLUS Smart Watch 44mm Scroll Button Control Series 6 with Extra Magnetic Strap
Xiaomi Air2 SE Wireless Bluetooth Earphone TWS Airbuds Pro 2SE SBC AAC Mi True Earbuds Long Standby Earbuds
ROMOSS Simple 10 Pocket Size 10000mAh Lithium Ion Power Bank
Ringke Fusion Matte Case For IPhone 12 Pro Max - Clear
Baseus Intelligent Sensor Fast QI Wireless Charger Air Vent Mount Mobile Car Phone Holder
Baseus 65W GaN 2 Pro Charger Quick Charge 4.0 3.0 Type C PD USB Charger With Type C To Type C Cable Foldable Pins
Redragon M692 BLADE Wireless 9-Button Programmable Gaming Mouse 4800 DPI
Baseus CRXCQC2-01 Mini Desktop Capsule Vacuum Cleaner
V07s Sports Blood Pressure Heart Rate Monitor Health Band - Blue
Flexible Octopus Tripod Stand Large - Black
Ringke Air-S iPhone 12/12 Pro Case - Lavender Gray
ROMOSS SW20 Pro 20000mAh Portable Power Bank PD 3.0 Fast Charging With LED Display
Xiaomi Mi Imilab KW66 Smartwatch 1.28 inch 3D TFT Full Touch Screen Smartwatch Double set of straps
Huawei Watch Fit
Baseus Cafule Series 3A Charging And Data Cable For Type-C - Black
Original Xiaomi Mi Power Strip With 3 USB Ports
A8 Multi-function Laptop Cooling Stand - Brown
Baseus Fast Protocols Convertible Fast Cable USB To Type C 5A 2m
Remax RP-W3 Wireless Charger For IPhone & Android - Black
QCY T3 TWS True Wireless Headset Binaural Bluetooth 5.0 In - Ear Running Headphones
Anker A8112 PowerLine Lightning 6 Ft Fast Charging Iphone USB Data Cable - White - Apple MFI Certified
Ringke Air-S iPhone 12 Pro Max Case - Lavender Gray
MJ33 RGB LED Soft Ring Light 20CM With Phone Holder
Swissgear 511 Backpack 15.6″ Laptop Bag
Tronsmart Onyx Ace Bluetooth 5.0 APTX TWS Earbuds
Silicon Power Ace A55 512GB SSD 2.5″
Realme Mini Speaker
SoundPeats True Wings True Wireless Earbuds With Ear Hooks
Remax RL-S20 Earphone Aux Share Jack Cable - Black
Baseus 65W GaN USB Type-C Fast Charger PD Wall Charger 3 Port Quick Charging Portable Travel USB Charger
Haylou GT1-XR Bluetooth 5.0 Earbuds Headphones QCC 3020 Chip High Quality APTX Wireless Earphones Headset Touch Control
Remax RB-T9 Bluetooth Handfree White
LED Video Light W49S Mini 6000K With Rotatable Mount Adapter
Realme Buds Q2 TWS Wireless Earphones Bluetooth 5.0 Earbuds Noise Cancellation 20 Hours playback Ipx4 Water Resistant Headphones
IP Wifi Camera Wireless Wifi Dual Lens Camera V380S CCTV 2MP Home Surveillance IR Night Vision
Baseus SUYL-TK01 Tank Gravity Car Mount Holder With Suction Base Tarnish – Silver
REMAX RB-M46 Desktop Bluetooth Speaker Subwoofer Bass Speaker Ambient Desk Lamps Support TFT Card AUX 360 Surround Sound
Original 1:1 Airpods Pro ANC Bluetooth 5.0 In Ear Headsets Wireless Headphones 1:1 airpods Pro TWS Headsets
Baseus Handheld Vacuum Cleaner For Car C1 3800Pa Powerful Auto Car Dry Cleaning Cordless Portable Wireless Mini Vacuum Cleaner
Our Brands
Enhance your practice of Online Shopping in Pakistan with Telectronics.pk
Why Chose Us:
Mobile Accessories:
Audio Accesories:
Smartwatches:
Security Gadgets:
Smart TV Box:
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
AddThisĀ FacebookĀ 
Speed optimizations
Score: 91
Failed: 2
Warnings: 0
Passed: 14
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 822.47 Kb to 79.4 Kb (90% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 4.95 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
87.8 %
8.33 Mb
javascript
8.3 %
804.65 Kb
html
1.6 %
152.96 Kb
css
1.2 %
115.48 Kb
font
1.0 %
98.37 Kb
other
0.1 %
9.01 Kb
TOTAL
100%
9.49 Mb
Requests by content type
Content type
Percent
Requests
image
90.5 %
372
javascript
4.4 %
18
html
1.9 %
8
css
1.5 %
6
font
1.5 %
6
other
0.2 %
1
TOTAL
100%
411
Content size by domain
Domain
Percent
Size
telectronics.pk
92.6 %
8.78 Mb
s7.addthis.com
2.2 %
216.46 Kb
pagead2.googlesyndication.com
1.8 %
178.28 Kb
connect.facebook.net
1.1 %
107.92 Kb
static.getbutton.io
0.9 %
84.63 Kb
fonts.gstatic.com
0.9 %
83.33 Kb
ssl.google-analytics.com
0.2 %
17.21 Kb
tpc.googlesyndication.com
0.1 %
11.75 Kb
maxcdn.bootstrapcdn.com
0.1 %
5.89 Kb
googleads.g.doubleclick.net
0.1 %
5.17 Kb
Other
0.1 %
8.15 Kb
TOTAL
100%
9.49 Mb
Requests by domain
Domain
Percent
Requests
telectronics.pk
91.7 %
377
pagead2.googlesyndication.com
1.5 %
6
fonts.gstatic.com
1.2 %
5
s7.addthis.com
0.7 %
3
fonts.googleapis.com
0.5 %
2
ssl.google-analytics.com
0.5 %
2
connect.facebook.net
0.5 %
2
googleads.g.doubleclick.net
0.5 %
2
facebook.com
0.5 %
2
tpc.googlesyndication.com
0.5 %
2
Other
1.9 %
8
TOTAL
100%
411
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 94
Failed: 1
Warnings: 0
Passed: 7
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 81
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved