seo site checkup logo
PricingFree ToolsArticles
Log in
Report generated 4 years ago
https://takistheme.blogspot.in
Your general SEO Checkup Score
Archived
84/100
SEO Score
6 Failed
0 Warnings
36 Passed
Issues to fix
Last found on May 22 2018, 05:28 PM
HIGH
We have found one URL that is not SEO friendly!
MEDIUM
LOW
Your webpage use the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
LOW
Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
LOW
Your webpage is using 6 inline CSS styles!
Common SEO issues
Score: 69
Failed: 3
Warnings: 0
Passed: 13
Google Search Results Preview
Desktop version
https://takistheme.blogspot.inTakis ThemeYOUR DESCRIPTION HERE
Mobile version
https://takistheme.blogspot.inTakis ThemeYOUR DESCRIPTION HERE
Keywords Cloud
accumsanadipiscingadvertisealfrangkialiquamametassociationsauctorbibendumblanditcategoriescommodoconsecteturcontactcopyrightcurabiturdictdisclaimerdolordonecdropdownduiselementumelitemailenimerrorfacebookfermentumfeugiatfinddatepost(root){post=root.feed.entry[];varfuscegooglegravidaiaculisintegerinterdumintroductionipsumlacinialectusliberoloremluctusmagnamalesuadamassamaurismodernitymollismorbinamebody=document.getelementsbytagname('head')[];varnequenewinclude=document.createelement('script');newinclude.type='text/javascript';newinclude.setattribute("src",home_page+"feeds/posts/summary//"+postlabel+"?startindex="+jsonstart+"&maxresults=&alt=jsoninscript&callback=finddatepost");namebody.appendchild(newinclude)}functionnewinclude=document.createelement('script');newinclude.type='text/javascript';newinclude.setattribute("src",home_page+"feeds/posts/summary?startindex="+jsonstart+"&maxresults=&alt=jsoninscript&callback=finddatepost");namebody.appendchild(newinclude)}functionnibhnullaodiopaddress="/search/label/"+postlabel+"?updatedmax="+timestamp+"&maxresults="+perpage+"#pageno="+nopage}location.href=paddress}paddress="/search?updatedmax="+timestamp+"&maxresults="+perpage+"#pageno="+nopage}else{varpharetrapolicyportapost.published.$t.substring(,)+post.published.$t.substring(,);varpostsposuerepraesentprivacyproinpulvinarqualityquantityquisquereadredirectlabel(numberpage){jsonstart=()*perpage;nopage=numberpage;varredirectpage(numberpage){jsonstart=()*perpage;nopage=numberpage;varrelationshipreservedrightsrisussagittissemperservicessitemapsocializationsubscribetakistellustemplatetermsthemethemeindie.comtimestamp=encodeuricomponent();if(currentpage=="page"){vartinciduntturpisullamcorpervivamusviverravolutpat}else{currentpage="label";if(thisurl.indexof("&maxresults=")==){perpage=}if(urlactivepage.indexof("#pageno=")!=){currentpageno=urlactivepage.substring(urlactivepage.indexof("#pageno=")+,urlactivepage.length)}else{currentpageno=}document.write('')}}}function
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Robots.txt Test
  • Congratulations! Your site uses a "robots.txt" file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • We have found one URL that is not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 10 'img' tags and all of them contain the required 'alt' attribute.
Inline CSS Test
  • Your webpage is using 6 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 10
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 84.05 Kb to 18.25 Kb (78 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 1.15 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 23
  • 2 HTML Pages
  • 3 CSS Files
  • 2 JS Files
  • 16 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
Score: 50
Failed: 2
Warnings: 0
Passed: 5
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage use the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
See results list
Canonical Tag Checker
  • Your page is using the canonical link tag. This tag specifies that the URL: https://takistheme.blogspot.in is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href='https://takistheme.blogspot.in/' rel='canonical'/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO for free right now!
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2009-2022 • All rights reserved