seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://sylvanianfamilies.co.uk
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 19 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
19 Failed
2 Warnings
45 Passed
Common SEO issues
Score: 42
Failed: 9
Warnings: 1
Passed: 12
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Home page | Sylvanian Families
Meta Description Test97% of top 100 sites passed
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://sylvanianfamilies.co.ukHome page | Sylvanian Families
Mobile version
https://sylvanianfamilies.co.ukHome page | Sylvanian Families
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
38basket36favourites33cookies9search8site
Keywords Usage Test81% of top 100 sites passed
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
ableacceptaccountadvertisingallowamusementanalyticsareababiesbabybasketbearboatbrowserbuddiesbundlecanalcheckboxcheckoutchooseclassicclickclosecobblestoneconsentcookiecookiescorrectlycostumecutiesdetailsdevicedirectlydisabledexperiencefairyfamiliesfamilyfavouritesfriendsfroggyfunctionfunctionalfurnitureguardianhavehomesimproveinformationitemsjavascriptkittyknowlabellandnecessarynewsletterninjasnurseryorderpagespartnerspasswordperformanceplateplayplaytimepolicypreferencespriceprivacyraincoatriversearchseriesservicessetssettingsettingsshippingshopsignsitespecialstoresylvaniantaletargetingtelephonetoggletraffictriotypesusedusuallyveggievehicleswebsiteworkyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Amusement Land
Trending Products
Keep in Touch
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 59
Failed: 6
Warnings: 0
Passed: 9
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 10,188 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 619.5 Kb to 48.84 Kb (92% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 5.04 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
87.9 %
8.38 Mb
javascript
8.7 %
846.08 Kb
font
1.5 %
147.89 Kb
css
1.5 %
144.66 Kb
html
0.3 %
27.93 Kb
other
0.2 %
16.90 Kb
TOTAL
100%
9.53 Mb
Requests by content type
Content type
Percent
Requests
javascript
67.6 %
190
image
19.2 %
54
css
5.0 %
14
html
3.9 %
11
font
2.5 %
7
other
1.8 %
5
TOTAL
100%
281
Content size by domain
Domain
Percent
Size
sylvanianfamilies.co.uk
97.6 %
9.30 Mb
cdn-ukwest.onetrust.com
1.2 %
118.51 Kb
apps.bazaarvoice.com
0.6 %
54.07 Kb
use.typekit.net
0.5 %
47.78 Kb
analytics-static.ugc.bazaarvoice.com
0.1 %
12.89 Kb
chimpstatic.com
0.0 %
919 B
api.bazaarvoice.com
0.0 %
696 B
network-eu-a.bazaarvoice.com
0.0 %
650 B
geolocation.onetrust.com
0.0 %
293 B
p.typekit.net
0.0 %
181 B
TOTAL
100%
9.53 Mb
Requests by domain
Domain
Percent
Requests
sylvanianfamilies.co.uk
93.2 %
262
cdn-ukwest.onetrust.com
2.5 %
7
apps.bazaarvoice.com
1.1 %
3
use.typekit.net
0.7 %
2
network-eu-a.bazaarvoice.com
0.7 %
2
chimpstatic.com
0.4 %
1
p.typekit.net
0.4 %
1
geolocation.onetrust.com
0.4 %
1
analytics-static.ugc.bazaarvoice.com
0.4 %
1
api.bazaarvoice.com
0.4 %
1
TOTAL
100%
281
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 78
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "sylvanianfamilies.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
*.sylvanianfamilies.co.uk, sni.cloudflaressl.com, sylvanianfamilies.co.uk
Not valid before
Wed, October 13o 2021, 12:00:00 am (z)
Not valid after
Wed, October 12o 2022, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 89
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 mx a ip4:77.68.2.176 a:server.sylvanianfamilies.co.uk ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved