seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://strategymmos.com/good-game-empire
Your general SEO Checkup Score
Archived
79/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 79 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
2 Warnings
30 Passed
Common SEO issues
Score: 69
Failed: 4
Warnings: 0
Passed: 11
Google Search Results Preview
Desktop version
http://strategymmos.com/good-game-empire/GoodGame Empire | Strategy Mmos WorldGoodgame Empire is a browser strategy game game in which you become the lord of a castle and turn your small fortress into the capital of the entire kingdom in
Mobile version
http://strategymmos.com/good-game-empire/GoodGame Empire | Strategy Mmos WorldGoodgame Empire is a browser strategy game game in which you become the lord of a castle and turn your small fortress into the capital of the entire kingdom in
Keywords Cloud
alertancientangelsaporiaareaarmyassembleauthorbattlesbrowserbrowser strategycancelcapitalcastlecategoriescommentscommunityconnectcreditdate: augdefenddesigndetailsdeveloper: goodgamedifferenteconomicefficientempireentireestablishexcitingextendfacebookfamilyfashiondfebruaryfortressforumsforumsfreegamegameplaygamesgamesallgenre: strategyglobalgoodgoodgamegreatkingkingdomlatestleagueleavelet'slikeloginlordmanagementmassivemightymilitarymmogamesnavigationneednewsnewslatestonlinepasswordplaypublishedrealmregisterregisterjoinreleaserememberreplyreservedreviewsreviewsfullrightsscreenshotssmallsociallysocialsocialstrategicstrategystrategymmosstrategymmos ©studiossubmitterritory. timestoggleturntypeuniqueunitsusernameviews
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage has 20 'img' tags and 17 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 34 inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the correct version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using: Facebook;
Speed optimizations
Score: 79
Failed: 2
Warnings: 2
Passed: 7
HTML Page Size Test
  • Congratulations! Your HTML size is 17.29 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 87.46 Kb to 17.29 Kb (80 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 13.049 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 154
  • 26 HTML Pages
  • 21 CSS Files
  • 66 JS Files
  • 41 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Your URL performed one redirect! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 0
Warnings: 0
Passed: 5
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 30
Failed: 3
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://strategymmos.com/good-game-empire/" />
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
SPF Records Checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved