seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://steadfastconsultants.in
Your general SEO Checkup Score
Archived
94/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 94 out of 100, which is higher than the average score of 75. Our analysis has identified 14 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
3 Warnings
51 Passed
Common SEO issues
Score: 69
Failed: 5
Warnings: 0
Passed: 17
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Steadfast Business Consultant
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: SBC is India’s leading tax consulting firm in India which provides a wide range of tax consultancy and advisory services to clients globally.
Google Search Results Preview Test
Desktop version
https://steadfastconsultants.inSteadfast Business ConsultantSBC is India’s leading tax consulting firm in India which provides a wide range of tax consultancy and advisory services to clients globally.
Mobile version
https://steadfastconsultants.inSteadfast Business ConsultantSBC is India’s leading tax consulting firm in India which provides a wide range of tax consultancy and advisory services to clients globally.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
India’s leading tax consulting firm | SBC
og:description
SBC is India’s leading tax consulting firm in India which provides a wide range of tax consultancy and advisory services to clients globally.
og:url
https://steadfastconsultants.in/
og:site_name
Steadfast Business Consultant
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
23services10business7financial6advisory5consulting
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
acceptachieveadvisoryaquisitionareasauditingbasebasedbusinessbusinessescapitalizecenterchallengeschangingclientclientscommittedcompanycomplexconditionsconsultationconsultingcontactcorporationscreatecrosseffectivenessefficienciesemailenhancedessentialestablishedexperienceexpertisefertilizationfinancialfulfillglobalgoodsgreatesthardesthelphelpedhelpinghopesimproveincomeindustryinfrastructureinnovativeknowledgelargeleadershiplegallifelifecyclemergersmodernizationmsmesnetherlandsnotificationsofferofficeopportunitiesoutsourcingpowerpricingproactivereceiveregulatoryreportingrequirementsrisksecretarialservicesshopsingaporesolutionssolvespreadsteadfaststopstrategicstrategytailortaxationteamtechnologytermstimelytouchtransfertransformativetrueunleashvaluationsvariedvirtualwishwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Tailor-Made Strategy For Your Business
Improve Your Business’ Efficiencies And Effectiveness
Strategic Solutions For Your Complex Challenges
Capitalize On Transformative Opportunities
Our Milestones
Services Overview
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 66
Failed: 5
Warnings: 2
Passed: 10
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 14.83 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,813 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 65.02 Kb to 14.83 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 3.14 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
82.6 %
2.09 Mb
javascript
9.2 %
238.19 Kb
other
4.0 %
104.05 Kb
css
2.2 %
56.35 Kb
font
1.3 %
33.05 Kb
html
0.7 %
19.12 Kb
TOTAL
100%
2.53 Mb
Requests by content type
Content type
Percent
Requests
javascript
38.1 %
16
image
26.2 %
11
css
23.8 %
10
other
7.1 %
3
html
2.4 %
1
font
2.4 %
1
TOTAL
100%
42
Content size by domain
Domain
Percent
Size
steadfastconsultants.in
89.9 %
2.28 Mb
cdnjs.cloudflare.com
4.9 %
125.79 Kb
googletagmanager.com
3.9 %
102.18 Kb
fonts.gstatic.com
1.3 %
33.05 Kb
fonts.googleapis.com
0.0 %
1.11 Kb
google-analytics.com
0.0 %
303 B
TOTAL
100%
2.53 Mb
Requests by domain
Domain
Percent
Requests
steadfastconsultants.in
81.0 %
34
cdnjs.cloudflare.com
7.1 %
3
googletagmanager.com
4.8 %
2
google-analytics.com
2.4 %
1
fonts.googleapis.com
2.4 %
1
fonts.gstatic.com
2.4 %
1
TOTAL
100%
42
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Some of your webpage's CSS resources are not minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.97 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.97 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img width="1529" height="519" src="https://steadfastconsultants.in/wp-content/uploads..." class="d-block w-100 wp-post-image" alt="" loading="lazy" srcset="https://steadfastconsultants.in/wp-content/uploads..." sizes="(max-width: 1529px) 100vw, 1529px">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.088. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0876

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Tailor-Made Strategy For Your Business By cross-fertilization of experience wit...
Html: <div class="carousel-inner">
Score: 0.0873
Server and security
Score: 86
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "steadfastconsultants.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
steadfastconsultants.in
Subject Alternative Names (SANs)
steadfastconsultants.in, www.steadfastconsultants.in
Not valid before
Mon, June 13o 2022, 12:00:00 am (z)
Not valid after
Sun, September 11o 2022, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
ZeroSSL RSA Domain Secure Site CA
Intermediate certificate
Common name
ZeroSSL RSA Domain Secure Site CA
Organization
ZeroSSL
Location
AT
Not valid before
Thu, January 30o 2020, 12:00:00 am (z)
Not valid after
Tue, January 29o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 84
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage uses the noindex meta tag. This means that your webpage will be read but not indexed by search engines.
See results list
Canonical Tag Test95% of top 100 sites passed
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:_spf.mail.hostinger.com ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved