seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://smeloan.sg
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 106 out of 100, which is higher than the average score of 75. Our analysis has identified 6 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
5 Warnings
61 Passed
Issues to fix
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
Common SEO issues
Score: 76
Failed: 2
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Best SME Loan Singapore [2024]- Free Loan Comparison Tool
Length: 57 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 149 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Compare all banks SME Loan finance schemes. FREE online loan assessment tool. See your best financing options instantly. Check eligibility and rates.
Length: 149 characters
Google Search Results Preview Test
Desktop version
https://smeloan.sg/Best SME Loan Singapore [2024]- Free Loan Comparison ToolCompare all banks SME Loan finance schemes. FREE online loan assessment tool. See your best financing options instantly. Check eligibility and rates.
Mobile version
https://smeloan.sg/Best SME Loan Singapore [2024]- Free Loan Comparison ToolCompare all banks SME Loan finance schemes. FREE online loan assessment tool. See your best financing options instantly. Check eligibility and rates.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:locale
en_US
og:site_name
SME Business Loan Compare Singapore
og:title
Best SME Loan Singapore [2024]- Free Loan Comparison Tool
og:description
Compare all banks SME Loan finance schemes. FREE online loan assessment tool. See your best financing options instantly. Check eligibility and rates.
og:url
https://smeloan.sg/
og:image
https://smeloan.sg/wp-content/uploads/2020/10/6f3ef7cd9f905fa42fcbdf8a78eb4e90-150x150.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
71loan48financing41banks35business26credit
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
loan
financing
banks
business
credit
Keywords Cloud Test
ableaccessaffectalternativeapplicationapplicationsapplyapprovalassessmentassistedavailablebankbanksbestbrokerbusinesscapitalchancescommercialcompaniescompanycompareconsultantcreditcriteriadifferentemailexpertisefacilitiesfamiliarfastfeesfinancefinancialfinanciersfinancingfirmformfreefundingfundsgovernmentgrowthhasslehavehelphigheridentifyinfoinstantlyinstitutionsjustknowlimitedlinkflowloanloanslonglowestmaximumminutemonthsmultiplenetworkoperationaloptionspersonalprocessproductsprofessionalprofileprojectprovideprovidedrateratesrecordrequirerespectiverevenuerightriskschemeschemessecureservicesingaporesmessolutionsstartstepsuitabletermtermstimetradeturnaroundvariousworkingyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Compare All SME Loans in Singapore
H2 tags
FREE SME Business Loan Assessment
Featured In
Best SME Loan Comparison Made Easy
See SME Loan Options In 3 Simple Steps!
SME loan criteria eligibility
SME Financing Institutions
What You Get
Government Assisted SME Loan Schemes
Free Loan Assessment
SME Loan Singapore FAQs
About Linkflow Capital
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 87
Failed: 2
Warnings: 1
Passed: 17
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,186 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 360.8 Kb to 88.22 Kb (76% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.04 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
font
41.6 %
229.09 Kb
other
33.9 %
186.54 Kb
html
16.4 %
90.59 Kb
image
7.0 %
38.52 Kb
javascript
1.1 %
6.19 Kb
css
0.0 %
0 B
TOTAL
100%
550.93 Kb
Requests by content type
Content type
Percent
Requests
font
30.8 %
4
image
23.1 %
3
other
23.1 %
3
javascript
15.4 %
2
html
7.7 %
1
css
0.0 %
0
TOTAL
100%
13
Content size by domain
Domain
Percent
Size
smeloan.sg
60.2 %
331.53 Kb
cdnjs.cloudflare.com
33.9 %
186.54 Kb
fonts.gstatic.com
6.0 %
32.85 Kb
TOTAL
100%
550.93 Kb
Requests by domain
Domain
Percent
Requests
smeloan.sg
69.2 %
9
cdnjs.cloudflare.com
23.1 %
3
fonts.gstatic.com
7.7 %
1
TOTAL
100%
13
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.468 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.468 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.828 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.828 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.83 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.83 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Compare All SME Loans in Singapore
Html:

Compare All SME Loans
in Singapore

Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0

0.1

0.25

Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "smeloan.sg" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
smeloan.sg
Subject Alternative Names (SANs)
*.smeloan.sg, smeloan.sg
Not valid before
Sat, July 6o 2024, 12:41:25 am (z)
Not valid after
Fri, October 4o 2024, 12:41:24 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R10
Intermediate certificate
Common name
R10
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://smeloan.sg/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://smeloan.sg/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved