seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://smartseo.pk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 103 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
3 Warnings
45 Passed
Common SEO issues
Score: 78
Failed: 3
Warnings: 2
Passed: 15
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Home One - Smartseo
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: mon - fri 9am - 7pm Twitter Facebook Youtube Welcome to SMART SEO Smart Web Design Agency Discover More welcome to SMART SEO Smart Web Design Agency Discover More We Shape the PerfectSolutions. We are committed to providing our customers with exceptional service while offering our employees the best training. We’re the best agency in […]
Google Search Results Preview Test
Desktop version
https://smartseo.pkHome One - Smartseomon - fri 9am - 7pm Twitter Facebook Youtube Welcome to SMART SEO Smart Web Design Agency Discover More welcome to SMART SEO Smart Web Design Agency Discover More We Shape the PerfectSolutions. We are committed to providing our customers with exceptional service while offering our employees the best training. We’re the best agency in […]
Mobile version
https://smartseo.pkHome One - Smartseomon - fri 9am - 7pm Twitter Facebook Youtube Welcome to SMART SEO Smart Web Design Agency Discover More welcome to SMART SEO Smart Web Design Agency Discover More We Shape the PerfectSolutions. We are committed to providing our customers with exceptional service while offering our employees the best training. We’re the best agency in […]
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
15design12smart10agency10developer9discover
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
adminagencyalterationarticlesavailablebelievablebestbrandingbusinessclientscommentcommittedconsiderablecontactcoredesigndesignerdesignersdeveloperdevelopmentdiscoverenterpriseentumestibulumexperiencefacebookfeaturesformframeworksfreegohargoinggraphichavehelphomehumourinjectedipsumjavascriptjustlahorelatestleaveliveloremlovemaheenmajoritymarketermarketingmediamehakmenumobeenmobilemohsinmuhammadmushtaqnaqashndissenewsonlinepassagepassagespersonphotographypointsportfolioposuereprojectsrandomisedrasoolrepeatresourcesrohansaeedsagittissanasaqibservicesshafiqshariksmartsmartseosolutionssufferedsuspetariqteamtendtwittervariationswasifwebsitewelcomewordpresswordsyasiryoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Smart Web Design Agency
H2 tags
We Shape the PerfectSolutions.
We’re the best agency in Lahore, Pakistan.
Experience us live.
We do more then ever platforms.
work showcase.
We’re trusted by more than 6260 clients.
Meet the expert team.
Great things in business are never done by one person. They’re done by a team of people.
Best design Agency solutions.
Latest news & articles.
Let's Get Your Project Started!
Robots.txt Test
  • This website is using a robots.txt file.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Speed optimizations
Score: 81
Failed: 2
Warnings: 1
Passed: 8
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 20.26 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 160.78 Kb to 20.26 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.16 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
62.4 %
1.39 Mb
font
15.9 %
362.96 Kb
javascript
12.7 %
289.40 Kb
css
6.4 %
145.61 Kb
html
2.6 %
58.31 Kb
other
0.0 %
0 B
TOTAL
100%
2.22 Mb
Requests by content type
Content type
Percent
Requests
javascript
38.0 %
38
image
27.0 %
27
css
23.0 %
23
font
10.0 %
10
html
2.0 %
2
other
0.0 %
0
TOTAL
100%
100
Content size by domain
Domain
Percent
Size
layerdrops.com
51.5 %
1.15 Mb
smartseo.pk
41.6 %
946.92 Kb
fonts.gstatic.com
4.3 %
98.11 Kb
googletagmanager.com
1.6 %
35.76 Kb
google-analytics.com
0.9 %
21.08 Kb
fonts.googleapis.com
0.1 %
2.81 Kb
TOTAL
100%
2.22 Mb
Requests by domain
Domain
Percent
Requests
smartseo.pk
79.0 %
79
layerdrops.com
10.0 %
10
fonts.gstatic.com
6.0 %
6
fonts.googleapis.com
2.0 %
2
google-analytics.com
2.0 %
2
googletagmanager.com
1.0 %
1
TOTAL
100%
100
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 65
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
SSL Checker and HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "smartseo.pk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
smartseo.pk
Subject Alternative Names (SANs)
smartseo.pk, www.smartseo.pk
Not valid before
Mon, November 8o 2021, 12:00:00 am (z)
Not valid after
Tue, November 8o 2022, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)
  • This webpage is using mixed content! While the initial HTML is loaded over a secure HTTPS connection, other resources (such as images, videos, stylesheets, scripts) may be loaded over an insecure HTTP connection, which may result in blocked content or unexpected page behavior.
See results list
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 0
Passed: 7
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://smartseo.pk is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://smartseo.pk/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:secureserver.net -all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved