seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://rosyshah.co.in
Your general SEO Checkup Score
Archived
63/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 63 out of 100, which is below the average score of 75. However, there are 23 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
23 Failed
3 Warnings
42 Passed
Common SEO issues
Score: 66
Failed: 8
Warnings: 0
Passed: 17
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Jalandhar Escort Service Available 24*7 Escorts
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: High Profile escort service provider in Jalandhar use of our escort one time i am 100% sure you again meet her.
Google Search Results Preview Test
Desktop version
https://rosyshah.co.inJalandhar Escort Service Available 24*7 EscortsHigh Profile escort service provider in Jalandhar use of our escort one time i am 100% sure you again meet her.
Mobile version
https://rosyshah.co.inJalandhar Escort Service Available 24*7 EscortsHigh Profile escort service provider in Jalandhar use of our escort one time i am 100% sure you again meet her.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
724escorts468girls336service49noida46sector
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
additionallyalmoraamravatiarunachalashokassamaurangabadbaghbestbhimtalbhowalichennaichhattisgarhcitycolonydehradundelhidharwadescortescortsestatefeelfemalesgeorgegirlgirlsgmailgujarathaldwaniharidwarhavehillshomeimphalinclinationsindianjalandharjangaonjharkhandkarnalkarnatakakashipurkattivakkamkeralakhanladieslocatemadhavarammadhyamaharashtramanalimanipurmarketmilkmizorammountmumbaimussooriemysorenagalandnagarnagpurnainitalnoidaplacepoonamalleeporurpradeshramnagarrampurreadrishikeshroadrosyrosyshahrudrapurruralsectorserviceservicessexualshahshamlishivamoggashorelinesikkimsouthtelanganatimetownurbanvaishalivanagaramviharvijayawadavisakhapatnamwarangalwestwonderfulyoung
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 66
Failed: 7
Warnings: 2
Passed: 13
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 20.76 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 6,475 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 186.06 Kb to 20.76 Kb (89% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 2.94 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
41.7 %
395.92 Kb
javascript
33.3 %
315.98 Kb
font
8.7 %
82.27 Kb
other
8.0 %
76.12 Kb
css
6.8 %
65.00 Kb
html
1.5 %
14.69 Kb
TOTAL
100%
949.98 Kb
Requests by content type
Content type
Percent
Requests
javascript
38.0 %
19
css
32.0 %
16
image
16.0 %
8
font
8.0 %
4
other
4.0 %
2
html
2.0 %
1
TOTAL
100%
50
Content size by domain
Domain
Percent
Size
rosyshah.co.in
65.8 %
624.97 Kb
static.getbutton.io
9.7 %
92.32 Kb
cdnjs.cloudflare.com
8.7 %
82.55 Kb
fonts.gstatic.com
8.7 %
82.27 Kb
maps.googleapis.com
5.7 %
54.01 Kb
img6.wsimg.com
1.2 %
11.40 Kb
fonts.googleapis.com
0.2 %
1.99 Kb
events.api.secureserver.net
0.0 %
486 B
TOTAL
100%
949.98 Kb
Requests by domain
Domain
Percent
Requests
rosyshah.co.in
72.0 %
36
fonts.gstatic.com
8.0 %
4
cdnjs.cloudflare.com
4.0 %
2
fonts.googleapis.com
4.0 %
2
maps.googleapis.com
4.0 %
2
events.api.secureserver.net
4.0 %
2
img6.wsimg.com
2.0 %
1
static.getbutton.io
2.0 %
1
TOTAL
100%
50
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.81 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.81 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="img-area" style="background-image:url(img/upload/rosy628103.jpg); b...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.016. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0157

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0149
Server and security
Score: 50
Failed: 5
Warnings: 0
Passed: 4
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is using an invalid SSL certificate! Modern browsers will block insecure connections and will mark the website as not secure so that the visitors will not see the website content. Having a valid SSL certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate has expired!

The hostname "rosyshah.co.in" is correctly listed in the certificate.

The certificate is self-signed and should not be trusted by web browsers!

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Root certificate
Common name
rosyshah.co.in
Subject Alternative Names (SANs)
rosyshah.co.in, mail.rosyshah.co.in, www.rosyshah.co.in, cpanel.rosyshah.co.in, webmail.rosyshah.co.in, webdisk.rosyshah.co.in, cpcontacts.rosyshah.co.in, cpcalendars.rosyshah.co.in, autodiscover.rosyshah.co.in
Not valid before
Sun, January 10o 2021, 5:04:30 am (z)
Not valid after
Mon, January 10o 2022, 5:04:30 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
rosyshah.co.in
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage is using mixed content! While the initial HTML is loaded over a secure HTTPS connection, other resources (such as images, videos, stylesheets, scripts) may be loaded over an insecure HTTP connection, which may result in blocked content or unexpected page behavior.
See results list
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 43
Failed: 3
Warnings: 1
Passed: 5
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved